(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE159

PENCW_10.PE159       Location/Qualifiers
FT   CDS_pept        join(complement(373055..373100),complement(372806..372972),
FT                   complement(372397..372733),complement(371963..372335),
FT                   complement(371242..371903),complement(371064..371167))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226730" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948759"
FT                   /orf_name="Pc13g01590"
FT                   /product="Pc13g01590 protein"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP91228.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012720"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI000183076F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1R9"
FT                   /transl_table=1
FT                   /translation="MAFNGQTPTIVVLKEGTDASQGKGQIISNINACVAVQGTVKSTLG
FT                   PYGGDLLLVDANGRQTITNDGATVMKLLDIVHPAARILTDIARSQDAEVGDGTTSVVVL
FT                   AGEILKEVRDLVEQGVSSQTIIKGLRRASAMAVNKVKEIAVDMMDASVSQEKKVETLRR
FT                   LAATAMNSKLIKRNSDFFTKMVVDAVLSLDQDDLNERLIGVKKVTGGGLQDSLFVDGVA
FT                   FKKTFSYAGFEQQPKHFENPSIVCLNVELELKSEKDNAEVRVEQVSEYQAIVDAEWQII
FT                   FNKLEAIYKTGAKVVLSKLPIGDLATQYFADRDIFCAGRVASDDMDRVCQATGAATQST
FT                   CTDIQARHLGTCGAFEERQIGGERFNLFSDCPRAKTCTLVLRGGAEQFIAEVERSLHDA
FT                   IMIVKRALRNTTIVAGGGATEMELSSYMHGFADRNVPHKQQAVVKAFAKALEVIPRQLC
FT                   DNAGFDATDILNRLRVEHRKGNTWAGVDFDKEGVRDNMVAFVWEPSLVKVNAIQAAVEA
FT                   SCLILSVDETIKNEESAQPGQQRGMPPGAAQRALRGRGRGMPRRG"
     atggccttca acggccaaac ccccacgatt gtcgtgttga aggagggcac agatgcttct        60
     cagggaaagg gtcagattat ctccaacatc aacgcctgtg tcgcagtgca aggaacagtc       120
     aagagcactc tcggtcctta cggtggtgat ctcctgctcg tggatgccaa cggcagacag       180
     acaattacaa acgatggagc cacagtgatg aagcttttgg atatcgtgca ccccgccgcc       240
     cgcattctta cggatatcgc tcggtcccaa gatgccgaag tcggtgacgg aacaacctcc       300
     gtggttgtcc tggctggtga gattctgaag gaggtgcgag acctcgttga gcagggtgtc       360
     agctcgcaga ccatcatcaa gggtctgcgg agggcaagcg ccatggcagt caacaaggtt       420
     aaggagattg cagtggacat gatggatgct tcagtcagcc aggagaagaa ggtcgagaca       480
     ctaagacggt tagccgcaac agccatgaac agcaagctta tcaagcggaa ttcggacttc       540
     ttcacaaaga tggttgtgga tgcggtactt tcgctggacc aggatgacct caacgagagg       600
     ttgatcggtg tcaagaaggt taccggtggt ggtctccagg attcgctttt cgtcgacggt       660
     gtggctttca agaagacttt ctcctacgcc ggtttcgagc agcagcccaa acacttcgag       720
     aaccctagta tcgtgtgctt gaacgttgag ctggaactta agagtgagaa ggacaatgcg       780
     gaagtccgtg tcgagcaggt ctcggaatac caggccattg tcgatgctga gtggcagatc       840
     atcttcaaca agcttgaggc tatctacaag acaggagcga aggtcgtgct tagcaagctg       900
     cctattggcg atcttgccac acagtacttc gcggaccgag acatcttctg tgctggccgc       960
     gtggcctccg acgacatgga ccgtgtttgc caggctaccg gagctgcaac ccaatcgact      1020
     tgcactgaca tccaggcgcg ccacctgggt acatgtggtg cattcgagga gcgccagatt      1080
     ggtggagagc gcttcaacct gttctccgac tgccctcgcg ctaagacttg cactctcgtt      1140
     ctgcgtggtg gtgctgagca attcattgcg gaggtggagc gtagtctgca cgatgctatc      1200
     atgattgtca agcgtgctct gcgcaacacc accatcgttg ctggcggtgg tgctactgaa      1260
     atggagttgt cgagctacat gcatggattt gccgaccgta acgtcccgca caagcagcag      1320
     gccgtcgtca aggcgttcgc caaggccctg gaggttattc cccgccaatt gtgtgataac      1380
     gctggcttcg acgctacaga tatcctgaac cgcttgcgtg tggagcaccg caagggtaac      1440
     acctgggctg gtgtggactt cgacaaggag ggcgtccgtg acaacatggt tgccttcgtt      1500
     tgggagccta gcctggtcaa ggtcaatgcc attcaggccg cagtggaggc ttcttgcttg      1560
     atcctgagtg tggacgaaac gataaagaat gaggagtcag ctcaacccgg tcaacagcgc      1620
     ggtatgccgc caggtgctgc ccaacgcgcc ctccggggcc gtggccgcgg catgcctcga      1680
     cgaggataa                                                              1689
//

If you have problems or comments...

PBIL Back to PBIL home page