(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE161

PENCW_10.PE161       Location/Qualifiers
FT   CDS_pept        join(375897..376709,376766..376779,376838..377646)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948761"
FT                   /orf_name="Pc13g01610"
FT                   /product="Pc13g01610 protein"
FT                   /protein_id="CAP91230.1"
FT                   /db_xref="UniParc:UPI0001830771"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S1"
FT                   /transl_table=1
FT                   /translation="MSPKVTSRRALNSKLGIYVDXSGCDQNVSFRRTGWSPLSVFLIQV
FT                   SQFYCDRRAQILSTYAXDRIVFSRIFRGSTDATVFENFIAQLLALRKPVPKPVLVMDNA
FT                   SFRYSERIAHICVDVGVKLVYLPPYSPDLNPIQEFSAELKAFINDTKVVVNTDQGFITF
FT                   LGWCIDVVGAKEESAMGHFRHECLTIEAKGWK"
     atggcagagc gtccgcaata cttcgagaat actttgaccc cgctatcaat caatacgacc        60
     actcttttcg agagccttga aaagcttcgt attgccgttc acaatggtgc cgagttgata       120
     caggagaaca ctcctttgcc tgaaacatgg ggcccaaatg gcatatttag agctttcccc       180
     ggtatttcga aatctagtcc cacatctcaa ccccataacc atctaaccac ccgattaagg       240
     aattgctctg gcattcctac gtctagatta tcagtcctcg gtgctagagg atcccaaagc       300
     tgcctctctt gactatcgtc gttacgcact gcaacggatt ccatcaagcc ttcccgacac       360
     tcctctgcta gtctcccgat tgtctccaat tggctcatct tcgcctgtca ctgccgtcac       420
     tctgcgcgtt ttaggtagtc tcgcaaagaa taattggcaa gatagcgcca atgtcagcat       480
     cgcaaaggag gatatcgctt gcctccacga ggccatgcag tgggcactaa agaacgagcc       540
     tcttgttacc catgatgacc ggaaaatggg tggagatgag atgctgtttg gccgagcagg       600
     ccttctttgg gtccttttga acgttcgtgc tcataacttt actcaagaga cgcaggaact       660
     cctctcgcct gtgctggagg caattcctga gttgatccga gtgattgtcg atgccgggcg       720
     acaaggatcc aaggaataca cagaaaagaa tggagcccaa gacgcacatc cattgatgta       780
     tgcatggatg gagggtcatt actgtttcgg ggcggtccac ggaataaccg gtattctaac       840
     catcctgctt tcgtgtaagc ccgaagagct tacggactat cttcccgtga ttggtggcac       900
     tatcactgca ctctgcaagc tatctggagc taccaatggc cacctcccaa tgacactacc       960
     tccatatagt tccagccagc gctcctcgga actagtccag ctgtgtcacg gcagccctgg      1020
     actgttgatt ctcctaggag ctgccttgaa aaacgaatcc ttaacccgcg cccactggga      1080
     tccaagttgg gaccaagcca tatacatggg cactcagcgt gtgtgggaag aaggtcttct      1140
     ttctaaggga ggcagtttgt gtcacggcgt gactggcaat gcatgggctt ggctcctgct      1200
     ccatgattgt tttgaatacc actcggatac tttgaacgat acccggacag cttgtctcca      1260
     gcgcaataaa atatcaactc ttccgaatgc tgaaatgagc caggagctca ctagtgactt      1320
     cttcctctcg agggcacttg cattcatgtt gcatgcacgt gagactaagc catacaacac      1380
     ctcgcctaca tcttccgaca aagattatcg catgcctgat gagccctaca gtctgtttga      1440
     aggacttgca ggcaatgttt gtgcctgggc tgatacatgc gcgttgcttc aagccaggct      1500
     gcgcaagatc gatcttgttg agcggggtgc gtgggctaca tctggttcat cgcaagactc      1560
     ggcattccag gatgctttcc atagacaatt gggctttcca gccctgggtg gaaatggcgc      1620
     aatgggtctt ttctag                                                      1636
//

If you have problems or comments...

PBIL Back to PBIL home page