(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE162

PENCW_10.PE162       Location/Qualifiers
FT   CDS_pept        join(377961..378150,378214..380636)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209737" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948762"
FT                   /orf_name="Pc13g01620"
FT                   /product="Pc13g01620 protein"
FT                   /protein_id="CAP91231.1"
FT                   /db_xref="UniParc:UPI0001830772"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S2"
FT                   /transl_table=1
FT                   /translation="MDLIPPSYESATDRDAWTIIARYIPSSDLCAASLVCHRWHGLFMP
FT                   FLWGDPASHFGTDNDAVYVALTRFRRTLKYARQEVRALTHTIHLPPALSEIYGGPRPGW
FT                   LRDILECLPCLQCLMVSKLPFFDHHAMTALKTNERSSHYNIRLLLAEREPNTTSASLAQ
FT                   TLLLFPVLTYLDLSYTTPARDRNVLSTLAQMPFLRVLKLRGIGLKDNDAEFLADAIGQR
FT                   VRCLDLRDNMLTDIAICSLLQKSFLPTSERERQQSPRPATASPDPFSHSAINESDSDFF
FT                   KRPDLDEQFAKLLAQPVLFHPWVEDLPYMGITHLYITGNRISLEAVASLLRSSRLHALD
FT                   FGTIKPPDKAHHTHPYGKEEYPGAETLVPVLGKIAGDNLTYLRAHHAVLTGQPQTQDAV
FT                   SDDEFLPELSAQESLREVEQFELDASQQVYELSEETRPVFELADTSTTESTGSYSTTKG
FT                   LKTSQMLTAHEDEPTPSVRRGPAFAPEVVQPIPIHSSANGGTAFAVSRTGTWNTEQTEG
FT                   STLPSISMSLDCDKLATDFSLQATLQCSSPISTNDSLEQKVQELLSKRPRNQSIPLQGG
FT                   KESWFPYLHPSHIPHMESLVLTDVPSHVTPNSSILSALTRFITACSNEALLATLQAGSD
FT                   YSLPPGRARMQAEQQRSRSLFGLRRLILEITPVDSTKLTSWKPANQYNATGHSSTGDRD
FT                   SENLWSAAANDFSFFGEEECGVPENDPGKYFPMAVLNEKVSLMPMEDDSLHSPDSPRLG
FT                   RHLPRSPQTPGPPMTAEDRKQQCQASMIDLVAELAAFRRGKKAEYERVVRRERERRSTL
FT                   GTGASGLLMPSSPHISLSHYVEGHWKGEVKIVRNPVPKVRTGTVDMYGNYFEKGYLYP"
     atggatctca ttcctccgtc ttatgaatct gcaacggata gagatgcttg gacaattatt        60
     gctcgctata tcccttccag cgacttatgc gctgcatctt tagtctgcca tagatggcat       120
     ggtctattta tgcccttcct ctggggtgat cctgcatctc attttggtac agataatgat       180
     gcagtatatg tggctctcac tcgattccga agaacactca aatacgcccg acaagaggtg       240
     cgggcgttga cccatactat tcatctccca cccgctctct cagagatata tggtggtccg       300
     cgaccgggct ggttgaggga cattctcgaa tgcctgccat gtcttcagtg tctgatggtc       360
     tccaagttgc ctttctttga tcaccatgcc atgacagcat tgaaaaccaa cgagagatcc       420
     agccactata atatacggct cttgctggct gagcgtgagc ccaatactac ctccgcaagc       480
     cttgcgcaga cgctcctctt gtttccggta ttgacctacc tggatctttc gtacaccact       540
     ccagcacgag atcgcaatgt actgtccaca ctagctcaaa tgccatttct ccgggtactt       600
     aagttgcgtg gcattgggct aaaggacaat gacgccgaat ttctagccga tgccattggg       660
     caacgagttc gttgtttgga tttgagagac aacatgctca ctgacattgc aatttgctcc       720
     ctgctacaga aatcctttct cccgacaagt gagagggaaa ggcagcaaag tccaagaccg       780
     gccacggctt cgccagaccc attctcgcac tctgcaatca atgagtctga ttcggacttc       840
     ttcaaacggc cagacttgga tgagcagttt gcgaagcttc ttgctcagcc tgttttattc       900
     catccatggg ttgaagactt gccatatatg ggaattacgc atctttatat cactggcaat       960
     cgaatatctc tggaagctgt agccagtctt cttcgctcgt cccggctaca cgctctggat      1020
     ttcggaacca taaaaccccc agataaggca catcatacac acccttatgg gaaggaggag      1080
     tatcccggag ccgagacgct agtcccagtg ttgggtaaga tcgcagggga caacctgacc      1140
     tatctacgag cgcatcatgc tgtgctcaca ggccaaccac aaactcaaga tgctgtgtcc      1200
     gatgatgagt ttcttccaga gctttcagca caagagagcc tccgcgaggt cgagcaattc      1260
     gagctggatg cctcccagca agtttatgag ttatccgaag agacaagacc tgtctttgaa      1320
     cttgcggata catcaacgac cgagtcaact ggctcatatt caacgacaaa agggctaaag      1380
     acctcccaga tgttgacagc ccacgaggat gagcctacac cgtcggtcag gcgtggaccg      1440
     gctttcgctc cggaggttgt acaaccaatc cctatacaca gtagcgccaa tggaggtacg      1500
     gcctttgctg tctctaggac gggcacctgg aatacagagc agaccgaagg aagcaccttg      1560
     ccatctattt caatgtcttt agactgcgac aagcttgcaa cggatttctc tctccaggca      1620
     accctgcaat gcagctctcc aatctcaaca aacgattctc ttgaacaaaa agtacaggaa      1680
     ttgttgtcaa agcggccacg taaccaatca atcccactcc aaggagggaa agaaagctgg      1740
     ttcccttacc tacacccatc acatattcct cacatggaat ctttggtgct gacagatgta      1800
     ccttcgcatg taacgccgaa ctcgtcgata ctctctgcgc tcactcggtt cattactgcc      1860
     tgctcaaacg aagcattgct agcaactcta caagcaggat cagactattc cctcccacca      1920
     gggcgagcgc gcatgcaagc cgagcagcag cgatcacgat ctctctttgg cttgcggcgt      1980
     ctaattctcg aaatcacacc tgtcgatagc accaaactga cctcgtggaa acccgcaaac      2040
     caatataatg ccaccggcca ttcaagcacg ggtgatcgcg actcggagaa tctttggtct      2100
     gcagccgcca atgatttcag cttcttcggt gaagaggagt gtggagtccc tgaaaatgat      2160
     cccggcaaat actttccaat ggctgtgctt aacgaaaagg tctcgcttat gcccatggag      2220
     gatgactcgt tacattctcc cgattcacct cgacttgggc gtcaccttcc acgaagcccc      2280
     cagacccccg gtccaccaat gactgctgaa gacagaaagc aacaatgcca ggcctcaatg      2340
     attgaccttg tggcagagct tgcggctttt cgtcgcggca agaaggctga gtatgagcga      2400
     gtggttcgtc gtgagagaga acggcgaagc acgcttggca cgggtgcttc cggtctactt      2460
     atgccatcat cgccccatat ttctttatca cattatgtcg aaggtcattg gaagggcgag      2520
     gtgaagatcg tgcggaaccc agtgccaaag gtacggaccg gaacagtaga catgtatggg      2580
     aactatttcg agaagggtta cttgtacccg tga                                   2613
//

If you have problems or comments...

PBIL Back to PBIL home page