(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE163

PENCW_10.PE163       Location/Qualifiers
FT   CDS_pept        join(complement(381731..381753),complement(381400..381527),
FT                   complement(381182..381284),complement(381011..381116))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000108824" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948763"
FT                   /orf_name="Pc13g01630"
FT                   /product="Pc13g01630 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP91232.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000892"
FT                   /db_xref="UniParc:UPI0001830773"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S3"
FT                   /transl_table=1
FT                   /translation="MVKKRANNGRNKNGRGHVKPVRCSNCARCTPKDKAIKRFTIRNMV
FT                   ESAAIRDISEASVFAEYSVPKMYLKLQYCVSCAIHGKIVRVRSREGRRNRAPPPRIRFN
FT                   KDGKKLQPPTAAKAL"
     atggtcaaga agagggcgaa caacggccgc aacaagaatg gccgcggcca cgtcaagcct        60
     gtgcgttgct ccaactgcgc tcgctgcacc cccaaggaca aggccatcaa gcgcttcacc       120
     atccgcaaca tggtcgagtc cgccgccatc cgtgatatct ccgaggcttc cgtcttcgct       180
     gagtactctg tccccaagat gtacttgaag ctccagtact gtgtgtcctg cgctatccac       240
     ggcaagattg tccgtgtccg ttcccgcgaa ggccgccgca accgtgctcc ccctccccgt       300
     attcgcttca acaaggacgg caagaagctc cagcccccta ctgccgccaa ggctctgtaa       360
//

If you have problems or comments...

PBIL Back to PBIL home page