(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE164

PENCW_10.PE164       Location/Qualifiers
FT   CDS_pept        join(382422..382472,382550..383423,383476..383570,
FT                   383625..384452)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209726" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977835"
FT                   /orf_name="Pc13g01640"
FT                   /product="Pc13g01640 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91233.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001830774"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S4"
FT                   /transl_table=1
FT                   /translation="MSAASSRQRQNQSKRDEAIRRKMEADLSKKRNAPAKSRNSRKAPP
FT                   GTVLALKPSQALQIKPSMSIAEAAQLMAAKREDCVLVTDDNERIAGIFTAKDLAFRVVG
FT                   LGLKAREVSVAEIMTKNPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGVLDITK
FT                   CFYDAMEKLERAYSSSRKLYDALEGVQTELGSSQPQQVIQYVEALRSKMSGPTLETVLD
FT                   GLPPVTVSVRTTVKDAAALMKENHTTALLVQDQGSITGIFTSKDIVLRVIAPGLDPSTC
FT                   SVVRVMTPHPDFAPSDMSIQAALRKMHDGHYLNLPVMNEGGEIVGMVDVLKLTYATLEQ
FT                   INTMSTQDDEGPAWNKFWLSMDHESDSMVSGGHSQQLNTPHRSVMSPDLARSGYDNSLL
FT                   PNDSASHHGDEHSEVISQHHPAEPAAPTPFPFKFKAPGGRVHRVNVLTTNGVTDLVSQV
FT                   TAKLGKEVEAVGGEPTVEEGRLSNTGYALSYMDNEGDTVSITTDQDMTDAIDLARRTHR
FT                   DKVNLFVHDPAQPPIPAPVEPQHVKIVTPIEEQSVVEESASQESPVSKALPQQQAVPAH
FT                   APEEQLIAGVPNDLLLPGAIVTLAAVIAGVFILSRPSGR"
     atgagcgccg caagtagcag acagcgacag aaccagtcga aacgtgatga ggctatccgc        60
     cgcaaaatgg aggccgacct cagcaaaaag aggaatgctc cggcaaaatc caggaactcc       120
     cgcaaagccc ctcccggcac cgtgcttgcc ctgaagccca gccaggccct ccagataaag       180
     ccctccatga gcatcgcaga ggccgctcag cttatggccg ccaagagaga ggactgcgtg       240
     ttggtcaccg acgataatga gcgcatcgcg ggtattttca ctgccaagga tctggcgttc       300
     cgcgtcgtcg gactgggcct gaaggcgcga gaggtctccg tcgctgagat catgaccaag       360
     aacccgttgt gcgcaagaac ggacactagt gctaccgatg cgctcgatct tatggtgcgg       420
     aagggattca gacatttgcc ggtcatggac gagaaccagg atatctctgg tgttttggat       480
     attaccaagt gcttctacga tgctatggaa aagttggagc gtgcatacag ttcatctcgt       540
     aagctgtacg atgcgctgga aggtgtgcag acagagcttg gctccagcca gccccagcaa       600
     gtcattcaat atgtggaggc cttgcgatcc aagatgtcgg gtcctaccct tgagactgtc       660
     ttggatggct tgccgccagt cactgtgtcg gtccgcacca ccgttaagga cgctgcggct       720
     ctgatgaagg aaaaccacac tactgctctg ctcgtccagg accaaggctc aatcactggc       780
     atcttcacta gcaaagatat tgttcttcgc gttattgctc ctggcctcga cccttctact       840
     tgcagtgtcg tccgtgtcat gactcctcac cccgatttcg ccccgtcgga tatgagcatc       900
     caagctgcgc ttcgcaagat gcatgatggc cactatctca acctgcccgt tatgaacgag       960
     ggtggtgaaa ttgtcggtat ggtggatgtg ttgaagctta cctatgccac tcttgaacag      1020
     atcaacacta tgtcaaccca ggacgacgag ggccccgcat ggaacaaatt ttggttatcg      1080
     atggatcacg agtcagactc tatggtctct ggcggccaca gccagcaact gaatacccca      1140
     caccgctcag ttatgagccc tgacctcgct cgctcaggtt acgacaacag tctccttccc      1200
     aacgactcag catcgcacca cggtgatgag cattctgagg ttatttctca gcaccaccca      1260
     gcagaaccag ctgctcctac tccgttcccc ttcaagttca aggcccctgg tggtcgagtg      1320
     caccgtgtga acgtccttac caccaacggc gttaccgacc ttgtgtcgca agttactgcg      1380
     aaacttggca aggaagtcga ggctgttggt ggcgaaccta ccgttgaaga aggtcggctg      1440
     agcaacactg gatatgcgct cagctatatg gataacgagg gtgataccgt ctccatcacc      1500
     acggatcagg atatgacgga tgccatcgat ctagcacgcc gtactcaccg cgacaaggtc      1560
     aatttgtttg tccacgaccc cgcccagcca cccattcctg cgccggttga accccagcat      1620
     gttaagattg tgactcctat tgaagagcaa agcgttgttg aggaatctgc atcacaagaa      1680
     tcccccgtga gcaaggccct gccccagcag caagccgtgc ccgcacacgc gccggaggag      1740
     caattgattg ccggtgtccc caatgacttg ctgcttcctg gtgccatcgt tacattggct      1800
     gcggtcattg caggtgtctt cattctcagc cgccccagtg gccggtaa                   1848
//

If you have problems or comments...

PBIL Back to PBIL home page