(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE165

PENCW_10.PE165       Location/Qualifiers
FT   CDS_pept        join(385192..385374,385506..385728,385799..385974,
FT                   386028..386459,386513..388578,388633..388840)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000209725" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948764"
FT                   /orf_name="Pc13g01650"
FT                   /product="Pc13g01650 protein"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="CAP91234.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001830775"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S5"
FT                   /transl_table=1
FT                   /translation="MSLLPPEIHTALSQLLSALGTPDNAVRSQAEDQLNNDWVQNRPDV
FT                   LLMGLAEQLGGATDTITRAFAAVLFRRIATKTRKDPATGDNKEIFSSLPSEQRIAIREK
FT                   LVVCLTSETVTDVRKKIGDTLAEVARQYTDNDEQWPELLGVLFQASQSPDSGVRETAYR
FT                   VFTTTPGIIEKQHEDAVVEVFTKGFKDDNISVRISAMEAFASLFRSISKKSQPKFFGLM
FT                   PDLLNILPPLKESSESEELSSALLALVELAEISPKMFKPMFNNLVKFSISVVGDKELSD
FT                   QVRQNALELMATFADYAPNMCKKEPEFAQEMVTQCLSLMTDVGADDDDAEEWNASEDLE
FT                   PEENDLNHIAGEQCMDRLANKLGGQAILQPAFSWIPRMMSSTNWRDRHAALMAISAISE
FT                   GCRDLMVGELDQVLALVVPALQDPHPRVRYAGCNALGQMSTDFAGTMQEKYHEIVLTNI
FT                   IPVLASTEPRVQSHAAAALVNFCEEAERSTLEPYLGNLLSHLLELLRSPKRYLQEQALS
FT                   TIATIADSAEAAFDQYYTTLMPLLLNVLKEEQGKEYRLLRAKAMECATLIALAVGKEKM
FT                   GQDALNLVQILGHIQQNIVDADDPQSQYLLHCWGRMCRVLGQDFVPYLPGVMPPLLTVA
FT                   AAKADIQLLDDEDQIEQVEQDEGWELVPLKGKIIGIKTSALEDKNTAIELITIYAQILE
FT                   QNFEPYVLETMEKIAVPGLAFFFHDPVRVSAAKLIPQLLNSYKKAHGGQSPGFAEMWNK
FT                   VAEKIIEVLSAEPTVDTLAEMYQCFYESVEVVGRNSLTPQHLQAFIESAKSTLEDYQMR
FT                   VKQRLEEQAELEDGDEENLDFEYAVEDDQNLLSDMNKAFHTIFKSQGNSFLPTWQQLIP
FT                   FYDAFITSQDPTQRQWALCIMDDVLEFCGEESWAFKDHIMQPLASGLRDENAANRQAAA
FT                   YGVGVAAQKGGAAWSDFVAASLPSLFQVTQHAQSRTEENVFATENASASIAKILHYNPS
FT                   KVQAPQDVVTNWIETLPITYDEEAAPYAYSFIAQLIDQQNPAVFAKADRVFGFIVQALE
FT                   AATLQGQTAARVATSAKQLVAVTGANADQILASVDPASQERVRKFFQ"
     atgtccctcc tacctcccga aatccacacc gcgctttctc agctgctcag cgccttgggc        60
     acacccgaca atgccgtcag atcacaggcg gaagaccagc ttaacaatga ctgggttcag       120
     aaccgaccag acgtcttatt gatgggattg gcggaacagc ttgggggtgc aacggataca       180
     ataacgcgtg ctttcgccgc tgtgcttttc cgaagaatcg caacaaaaac ccgaaaggat       240
     cccgccacag gtgacaacaa ggagattttc tcgagcctcc ccagcgagca gcgaatcgcc       300
     attcgtgaga agctggttgt ctgtctgacc agtgagactg tcaccgatgt acgcaagaag       360
     attggagaca cgctggctga ggtggctcgg caatacaccg ataatgacga acagtggcct       420
     gaactcctcg gcgttctctt ccaagcaagc caaagccctg actcaggcgt tcgggaaacc       480
     gcataccgtg tttttacgac cacccccggt atcattgaga agcagcacga agacgctgtg       540
     gtggaagtct ttaccaaggg tttcaaggat gataatatct ccgtgcggat ttccgctatg       600
     gaagccttcg cttcgttgtt ccgatcgatc tccaaaaagt cccagcccaa attcttcggc       660
     ctcatgccag accttctcaa catccttcct cccctcaagg agtcctctga gagcgaggag       720
     ctatcctcgg ccctgctcgc cctggttgaa ttggccgaga tcagcccgaa aatgttcaag       780
     cctatgttca acaacttggt taagttcagc attagtgtcg ttggcgacaa ggagctcagt       840
     gaccaggtgc gccagaacgc tctcgagttg atggctacct ttgccgatta tgccccgaat       900
     atgtgcaaga aggagccgga gttcgcacag gaaatggtca cacaatgtct gagtctgatg       960
     actgatgtcg gtgcggatga cgacgatgcg gaggagtgga acgcgtcaga agatcttgag      1020
     cctgaagaga acgaccttaa ccacatcgcc ggtgagcagt gcatggatcg tctcgccaac      1080
     aagctgggtg gacaggccat cctccagccc gcattctctt ggattcctcg catgatgtcc      1140
     tctaccaact ggcgcgaccg ccatgctgcc ttgatggcca tttccgccat ctctgaaggt      1200
     tgtcgcgacc tgatggtcgg tgagctggac caagttctag cccttgttgt ccctgccctc      1260
     caagaccccc acccccgagt ccgctatgca ggctgcaacg ccctcggtca aatgagtacc      1320
     gactttgccg gtaccatgca agagaagtat cacgagattg tcctcactaa catcattccc      1380
     gttctcgcct ctaccgagcc gcgtgtgcag tcccacgctg ccgccgctct cgtcaacttc      1440
     tgtgaggagg cagagcgtag cacattggag ccatacctcg gaaaccttct cagccatctc      1500
     ctggaactgc tgcgcagccc taagcgttat ctgcaggagc aagcgctgtc cactattgcc      1560
     actattgccg attcggccga ggccgccttc gatcagtact atactactct gatgcctctt      1620
     ttgctcaatg tcctcaagga ggaacagggt aaggagtacc gccttcttcg tgccaaggcc      1680
     atggagtgtg ctactctgat cgcactggcc gttggcaagg aaaagatggg tcaagatgcc      1740
     ctgaaccttg ttcagattct cggccacatc caacaaaaca ttgtcgacgc cgacgaccca      1800
     cagtcacagt acctcctcca ctgctggggc cgcatgtgcc gcgtcttggg ccaagacttc      1860
     gtgccttatc tccccggtgt tatgccgcct cttctaaccg tggctgcggc caaggccgat      1920
     attcagctgc tggatgacga ggatcaaatc gagcaggttg agcaagatga gggctgggag      1980
     ctggtgccgc tcaagggcaa gattatcggt atcaagacga gtgctcttga agacaagaat      2040
     actgctatcg aattgatcac gatctacgcc caaattctcg agcagaactt cgagccctac      2100
     gtcctggaga ccatggagaa gattgccgtc cctggccttg cctttttctt ccacgacccc      2160
     gttcgcgtgt cagctgccaa gctaatcccc cagctactga actcctacaa gaaggcacac      2220
     ggtggccagt cgccgggctt cgccgaaatg tggaacaagg ttgcagagaa gatcatcgag      2280
     gtccttagcg ctgagccgac agttgacacc ttggctgaga tgtaccagtg cttctacgag      2340
     tcagtagagg tggttggcag aaactccctc accccccagc acttgcaggc gttcattgaa      2400
     tcagcgaagt cgacccttga ggactaccag atgcgcgtga agcaacgttt ggaggagcag      2460
     gccgagctcg aggatggtga cgaggagaac ctggacttcg agtacgccgt ggaggacgat      2520
     caaaacctat tgagcgatat gaacaaggca ttccacacca tctttaagag ccagggcaac      2580
     tcgttcctgc cgacgtggca gcaattgatt ccattctacg acgcttttat cacaagccaa      2640
     gacccgacac aacggcagtg ggcactttgc atcatggatg acgtgcttga attctgtggc      2700
     gaagagtcgt gggcatttaa ggaccatatc atgcagccct tggcttcagg tctgcgagac      2760
     gagaacgccg ccaaccgtca ggcagcggcg tacggagtgg gcgtggccgc acagaagggt      2820
     ggtgccgcct ggagcgactt tgtggcagcc agcctcccca gcttgttcca ggttacacag      2880
     catgcgcagt cccgcacaga ggagaatgtg ttcgcgaccg agaatgcatc tgccagtatt      2940
     gccaagatcc tgcactacaa cccatccaag gtccaggcgc cccaggatgt cgtgaccaac      3000
     tggatcgaga ctttgcccat tacctatgac gaggaggctg ctccctatgc ctattccttt      3060
     attgcacaat tgattgacca gcaaaacccg gccgtctttg ccaaggctga ccgtgtcttc      3120
     ggtttcatcg tgcaggcact cgaggcggct accctgcagg gccagaccgc tgcccgggtg      3180
     gccacatccg ccaagcagct ggtggcagtg accggcgcaa atgcagacca gattctggct      3240
     tctgtggacc cggccagcca ggagagagtg cgcaagttct tccaataa                   3288
//

If you have problems or comments...

PBIL Back to PBIL home page