(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE166

PENCW_10.PE166       Location/Qualifiers
FT   CDS_pept        join(complement(390005..390233),complement(389534..389906),
FT                   complement(389102..389456))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000206361" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824608"
FT                   /orf_name="Pc13g01660"
FT                   /product="Pc13g01660 protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91235.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001830776"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S6"
FT                   /transl_table=1
FT                   /translation="MSLAKDILLFGATGTIGSFILDAILTERPQFGRVAIFTSPHTAEA
FT                   KASQLNKLKEQGVEVIVGNVEDENDVKAAYEGIDTVISALGRNALAQQIPLIRLAAASP
FT                   TVKWFLPSEYGTDIKYGPASANEKPHQLKLKVRAYLEDEISRDDLAYSYVVTGPFAEMY
FT                   LNLLPGMEEAGGWDVKGRRAVLLGEEGKGEVSLTTMTDVGTLVLNTLLHATAETRNAAL
FT                   CVNSFTTGPDQIQAEFERQLGGQPWDVSRTSLAKLREAEAAAWDAGNPAATVLTLRRIW
FT                   GEGGTLYSERANGLIGEPKMMGLEEVVANEIQRVSKL"
     atgtctctcg ccaaggacat tctcttattc ggcgcaacag gcaccattgg ctcattcatc        60
     ctggacgcca tcctgaccga gcgcccccaa ttcggccgcg tcgccatctt cacttccccg       120
     cacacagccg aggcaaaagc ctcgcagctg aataagctga aagagcaagg cgtagaagta       180
     attgtgggta atgtcgaaga tgagaatgac gtgaaagcag catacgaagg aatcgacacg       240
     gtgatttcag ccctgggccg caatgccctg gcccaacaga tccccctcat tagactcgcg       300
     gctgccagcc ccactgtgaa atggttcctg ccttccgagt acggcacgga tatcaagtac       360
     gggccggctt cagcgaacga gaagccgcac cagttgaagc tgaaggtgcg cgcctatctc       420
     gaagatgaga tctcgcgtga cgacctcgcc tattcgtatg tggtcactgg cccattcgcg       480
     gagatgtatc tgaatctcct gcctggaatg gaggaggctg gtgggtggga tgttaaaggc       540
     cggagggcag tcttgttagg tgaggagggg aagggagagg ttagtttgac gacgatgaca       600
     gatgttggaa ctctcgtctt gaacactctg cttcatgcta cggccgagac gcgcaacgct       660
     gccttgtgtg ttaattcgtt tactacgggc cccgaccaga ttcaggcaga atttgagcgc       720
     cagcttggtg gtcagccgtg ggatgtgtct cgcacatcac tggcgaagtt gcgcgaggcg       780
     gaggccgcgg cgtgggacgc tggaaatccg gcagctactg tgttgacttt gcgtcggatc       840
     tggggtgaag gcgggacgct gtattcagag cgggctaacg gactgattgg ggagccgaaa       900
     atgatggggt tggaggaggt ggttgctaat gagatccaga gggtatcgaa gttgtag          957
//

If you have problems or comments...

PBIL Back to PBIL home page