(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE167

PENCW_10.PE167       Location/Qualifiers
FT   CDS_pept        join(complement(391847..392731),complement(391606..391785),
FT                   complement(390574..391440))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217084" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948765"
FT                   /orf_name="Pc13g01670"
FT                   /product="Pc13g01670 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91236.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniParc:UPI0001830777"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S7"
FT                   /transl_table=1
FT                   /translation="MAQLYWPSVVLILWSLFSLSTADTCWRETTCSGPTNTAFSGPWEK
FT                   NIYAPASRTVRPASTLSELKTNAVTDPAHPYKATLYGNGSIIVFDFGIEVGGIVHLDYT
FT                   STGSGALGLAFTEAKNWIGEWSDSSSALYHDGALYANISSTGKGTYVMPDKYLRGGFRY
FT                   LTVFLLTDYSTSVQIEDLTLELAFKPTWANLRAYQGYFHCSDELLNRIWYSGAYTLQTN
FT                   EVSVDTGRVTKGVTSGWVNNGTLGPGDTIIVDGAKRDRAVWPGDMGIAVPSAFVSLGDL
FT                   ESVKSALQIMYNTQNKTTGAFDESGPPLSQKGSDTYHMWSMIGTYKYVLYTNDTDFLFK
FT                   NWASYQHAMEYIYGKTGASLALWAGDSTNLSSIWSSQAANLKKAINTYCWDESYGAFKD
FT                   NATNTSLHPQDANSMAIMFGVVNEERTASISEKLLKNWTPIGAVAPELPENIASFISSF
FT                   EIQSHFIAHKPARALDLIRRSWGWYINNPNGTESTVIEGYLQNGTFGYRMDRGYGYDPS
FT                   YVSHAHGWSSGPTSALTEYVVGLSVVSPLGLTWKIAPQFGDLEFAEAGFVTSLGKFQAS
FT                   WILNSSGYVLTFSVPKGTDGNVTLPYVTASKKPSITIDGDQLMRGVAYADGAATVEVTG
FT                   GSHKVVVT"
     atggcacaac tatactggcc tagtgtggta ttgattcttt ggtctctctt ctcgctatct        60
     actgcagaca cttgctggcg tgagactact tgctctggac ctacaaacac tgcattcagc       120
     gggccatggg aaaagaacat atacgcaccg gcatcgcgga cagtacgacc ggcctcaacc       180
     ttatcagaat tgaaaacgaa cgctgttaca gaccctgcac atccatacaa agcaacatta       240
     tacggaaacg ggtcaattat cgtgtttgac ttcggtattg aagttggcgg catcgtccat       300
     ctggactata cctccaccgg cagcggagct ctgggactgg cgttcacaga agccaaaaat       360
     tggattggag agtggtcgga ctcgtcaagc gctctatatc atgacggcgc tttgtatgcg       420
     aatatttcat caactggaaa gggtacatat gtcatgccag acaaatacct gcgtggtgga       480
     ttccggtact tgacggtctt cttgctcaca gattattcaa ccagtgttca gattgaagat       540
     ctgaccttag agcttgcgtt taagcccact tgggcaaacc tcagagctta ccaggggtac       600
     tttcattgca gtgatgagct tttgaatcgc atctggtata gcggtgcata taccctgcaa       660
     acgaatgagg tctccgtgga cactggccgc gttaccaagg gtgtcacatc tgggtgggta       720
     aacaatggga ctctcgggcc gggagacacg attattgttg atggcgcaaa gcgagatcgt       780
     gcggtttggc ccggtgatat gggaattgcc gttccttccg ccttcgtgag tctgggagac       840
     ctggaaagtg taaagagcgc tttgcagatc atgtacaaca cccagaacaa gacaacaggt       900
     gcttttgatg agtcagggcc tccgttgagc caaaagggct cagacacata tcacatgtgg       960
     tctatgattg gcacctataa atacgtgctt tataccaatg atacagactt cttatttaag      1020
     aactgggcca gttaccagca cgccatggaa tatatatatg gaaagacagg ggcatctctc      1080
     gctttgtggg ctggagactc aaccaatcta tcaagcatat ggagttccca ggccgccaat      1140
     ctcaaaaaag caatcaacac ctattgctgg gacgagtcgt acggcgcatt taaggacaat      1200
     gcaaccaata cctctctgca tccacaagat gctaacagca tggcgattat gtttggtgtt      1260
     gtaaatgaag agcgcacagc cagcatttcc gagaagctgc tcaagaattg gacccccata      1320
     ggggccgtag ctcctgaatt gccagagaac attgcgtcat tcatatcctc tttcgagatc      1380
     caaagtcact ttattgccca caaacctgca cgcgcactgg atctcattcg tcgcagctgg      1440
     ggctggtaca tcaacaaccc gaatggcaca gagagcactg tgattgaggg ctatctacag      1500
     aacgggactt tcgggtatcg gatggaccgc gggtatggct atgatccatc atatgtctca      1560
     catgcacatg gctggtcctc cggcccgacc tctgcattga cagagtatgt tgtcggtctt      1620
     tctgtggtct cgccgctagg attgacgtgg aaaattgcgc cgcaatttgg tgatctggaa      1680
     tttgccgagg ctggctttgt cacctctctt gggaagtttc aagcgtcttg gattttgaat      1740
     tcgagtggat atgtgttgac tttctcagtg ccaaagggta ctgatgggaa tgtcactttg      1800
     ccctatgtca ccgcgtcgaa gaagccttcg attactattg atggtgacca gttgatgaga      1860
     ggagtggctt atgctgatgg tgctgcaact gttgaagtta ccggtggctc tcacaaggtt      1920
     gttgtcacat aa                                                          1932
//

If you have problems or comments...

PBIL Back to PBIL home page