(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE168

PENCW_10.PE168       Location/Qualifiers
FT   CDS_pept        join(393481..393828,393954..394460,394537..394908)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000243333" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948766"
FT                   /orf_name="Pc13g01680"
FT                   /product="Pc13g01680 protein"
FT                   /function="metal ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91237.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="UniParc:UPI0001830778"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S8"
FT                   /transl_table=1
FT                   /translation="MSGETVRPAFEGRERPLLSYGIAFPAATARHLDGTFRASRVYVIC
FT                   SGSLSRNTNVMDQLETALEPDRLVGHWIGMRSHTLWSEVLQIAEEVQTAHADLLLTVGA
FT                   GSLTDGAKIIALVLANRVSTPEELETLAEGPKKRKYIEAPTLPIISVPTSLSAGEYSNF
FT                   AGGTEDHSKRKYSFQPPIRGPELVILDPWLAKTSPGSIWLSTGVRAMDHCIESLCAIAG
FT                   TTTKSDKLALNALGLLVPGLLRCKRDRSDREAHLQCQLGSVDAMAACTSGSIELGASHG
FT                   IGHQLGPLGVGHGETSCILLPAVCKFNAKYNANREKQARVRQFLIQDPIVSDVLRARSV
FT                   NVETSDLGDILDAIIRELGMPRSLSDVQVGRDQLDGLAENSLHDRWCKTNPVPLKEKSQ
FT                   VLEILEMVV"
     atgtcagggg aaacagttcg acctgccttt gaaggccgtg agcgcccact tctttcctat        60
     ggcattgcct ttcccgcagc tacagcacgc catctcgatg gcacatttcg ggcttcccgt       120
     gtatatgtga tctgctcagg gtcattgtcg cgaaacacca atgtaatgga ccagctagag       180
     accgctctag agccagacag actggttggt cattggatcg gtatgcggag ccacactttg       240
     tggtcagagg tgctgcagat tgccgaagag gtccaaactg cgcatgctga tctgctcttg       300
     accgtcggag ctggcagctt gaccgatggt gcgaagatca ttgcattagt cctcgcaaat       360
     cgagtcagca caccagaaga gctcgaaacc cttgcggaag gccccaaaaa gcgaaaatat       420
     atcgaggcac caactctccc gatcatttcc gtgccaactt ccctttccgc cggcgaatac       480
     tccaactttg caggtggcac agaagaccac tcaaagcgca aatacagctt tcagccaccg       540
     attcgtggac cagagctggt tattcttgac ccttggctag caaaaacgtc ccccggttca       600
     atctggctca gtacaggtgt gcgcgcaatg gaccattgta tcgaaagtct ttgtgcgatc       660
     gcaggtacga ccactaaatc cgacaaacta gctctaaatg cactggggtt gttggtacct       720
     ggtctcttgc gctgtaagag ggatcgatca gaccgtgaag cgcacctaca atgccaactc       780
     ggctcagtgg acgctatggc ggcctgtact agcgggtcaa ttgaattggg tgctagccat       840
     gggattggac atcagcttgg tccactgggt gtcggccacg gtgaaactag ttgtatcttg       900
     ctccctgctg tgtgtaagtt caatgctaag tacaacgcca accgcgaaaa acaagctcgt       960
     gtgcgccaat ttttgattca agatccgatc gtgtcggatg tgctgcgtgc ccgctctgtc      1020
     aacgtggaaa cctccgactt gggcgatatt ttggatgcta ttatccgcga attgggaatg      1080
     cctcggtcct tgagcgatgt ccaagtaggg cgggaccagt tggatgggct ggcggagaat      1140
     agcctacatg accgttggtg caagacaaac ccagtgccac tgaaggagaa gtctcaggta      1200
     ttggagattc tggagatggt agtctga                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page