(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE169

PENCW_10.PE169       Location/Qualifiers
FT   CDS_pept        395829..397076
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210183" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949802"
FT                   /orf_name="Pc13g01690"
FT                   /product="Pc13g01690 protein"
FT                   /function="intramolecular lyase activity"
FT                   /biological_process="cellular modified amino acid
FT                   biosynthetic process"
FT                   /protein_id="CAP91238.1"
FT                   /db_xref="GO:0016872"
FT                   /db_xref="GO:0042398"
FT                   /db_xref="InterPro:IPR003466"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="UniParc:UPI0001830779"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1S9"
FT                   /transl_table=1
FT                   /translation="MASTLRQNPWWAYQSLTRQQLRTSRLSSRHLSTTPLRSNASNNPL
FT                   RSRASAAADLQHAAQAQRRMILSAAGIITCAAGLYGVIKLDLFGLNELDTNKDDKTTPP
FT                   KNGAMRMDGPVGFTNGGPSLITIKGQDRLEQVPTGTSTIPTFPSTIRLPTPEATEGKQT
FT                   GDDLAPSAGEEYQLLGLGIRTVSFLSIQVYVVGLYVAKSDITELQRRLLRTAIHPPTTD
FT                   DDAAISGAGATAATSLVSPERQQLRELLLDPEHGDAAWSAIIKDNGIRTAFRIVPTRNT
FT                   DFMHLRDGWVRGITARAQAKKTAEPGEFQDESFGSSMNDFKAVFGSGKGKSVPKGQTLV
FT                   LMRDAHGALDALFQPGADKPVKWMGRVADERISRLVWLNYLAGKNVSSEGARASIVDGL
FT                   MTIVERPLGTVVQKVI"
     atggcctcca ccctccgtca aaacccatgg tgggcctacc aaagcctcac ccggcaacaa        60
     ctccgcacat cacgcctctc ctcccggcat ctctccacca cgcccctccg ttccaatgca       120
     agcaataatc ctctccgctc ccgagcatcc gcagcggcgg atctccagca cgccgcccaa       180
     gctcaacgga gaatgatcct ctccgcagct ggaataatca cctgcgcagc tggtctctac       240
     ggcgtcatca agctagacct attcggcctc aacgaactag acaccaacaa agatgacaag       300
     accacacccc cgaagaacgg cgcaatgcgc atggacggac cagtcggttt caccaacggc       360
     ggcccatcat taataacaat caaaggccaa gaccgactcg agcaagttcc aacaggaaca       420
     agcacaatcc ccaccttccc aagcacaatc cgactcccca cccccgaagc aacagaaggc       480
     aaacaaaccg gcgatgatct agccccatcc gcaggcgaag aataccaact cctaggcctg       540
     ggaatccgca ccgtctcctt cctctcaatc caagtctacg tggtcggcct gtacgtcgcg       600
     aaatccgaca taaccgagct acaacgacgt ctgctacgca cagcaatcca cccacccact       660
     accgacgacg atgccgccat ttccggcgcc ggcgcaacag ccgctacctc cctcgtctcg       720
     cccgagcgcc agcagctacg ggagctactc cttgaccccg agcacggcga cgccgcctgg       780
     tcggctatca tcaaggataa cgggatccgc actgctttcc gcatcgtgcc cacccgtaac       840
     acggacttta tgcatctgcg tgacggatgg gtgcgtggta ttactgcgcg cgcgcaggcg       900
     aagaagacgg cggagccggg cgagttccag gatgagagct ttggaagctc gatgaatgac       960
     ttcaaggctg tttttggttc tgggaagggg aagtctgtgc cgaagggaca gacgcttgtt      1020
     ttgatgcgtg atgcgcacgg cgctttggat gcgcttttcc agcctggggc tgataagccg      1080
     gttaagtgga tggggcgtgt tgctgatgag cggattagtc ggcttgtttg gttgaattat      1140
     ctggctggca agaatgtttc gagtgagggg gcccgggcga gtattgtcga cgggttgatg      1200
     acgattgtgg agaggcccct tgggaccgtg gtgcagaagg ttatctga                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page