(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE17

PENCW_10.PE17        Location/Qualifiers
FT   CDS_pept        join(complement(38276..38306),complement(37398..38068))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824329"
FT                   /orf_name="Pc13g00170"
FT                   /product="Pc13g00170 protein"
FT                   /protein_id="CAP91086.1"
FT                   /db_xref="UniParc:UPI0001830D03"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G6"
FT                   /transl_table=1
FT                   /translation="MNAVKIGATTRGVSTFRESVPKKVPFRAQHLVLEAVQKMLEQSGF
FT                   RFVQRWLPQACRSAEWVCAESMELHRLFPLLNQNRKYASSKDFHQILAKLHSLRHTVSN
FT                   IRHAAVHRIVQDSESLLEMLQAAVAFASCIGDKECTQQLEFLCSTLNNLLFQMNERLHH
FT                   LQQRVLVQIRICHSRPAELMQRRALLPEAVRRLTEQSEDMFDLQVQGILRKNLLLCWYE
FT                   ASNQPSALQVS"
     atgaatgccg ttaagattgg agcaacgact cggggtgttt ccacgtttcg agagagcgtc        60
     cctaagaagg tgcctttccg cgctcagcac cttgtcctag aagcagtgca aaaaatgttg       120
     gagcaaagtg gattccgctt tgtccaacgc tggctacccc aggcgtgtcg gtcggccgag       180
     tgggtttgtg cagagtcaat ggagctgcac agactcttcc cacttttgaa ccaaaataga       240
     aaatacgcat cttcgaaaga ttttcaccag atattggcta agcttcacag cctaaggcat       300
     acagtgtcca atatacgcca tgcggcagtc cacagaatcg ttcaagatag cgaatccttg       360
     cttgaaatgc ttcaggctgc tgttgctttc gctagctgca taggcgataa ggaatgtaca       420
     cagcaactcg aattcctttg cagtactttg aataatttac tgtttcaaat gaatgagcgc       480
     ttacaccatc ttcagcagag ggtattagtt cagattcgga tatgtcactc ccgtccagca       540
     gagctgatgc aaaggcgtgc ccttcttcca gaggcagtcc gaaggttgac agaacaaagc       600
     gaagacatgt ttgatttaca ggtacaaggc atcttaagaa agaacctatt gttgtgttgg       660
     tatgaggcaa gcaaccaacc ctctgcttta caagtctcct ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page