(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE170

PENCW_10.PE170       Location/Qualifiers
FT   CDS_pept        join(complement(397712..397862),complement(397430..397584))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000095204" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978061"
FT                   /orf_name="Pc13g01700"
FT                   /product="Pc13g01700 protein"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAP91239.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011899"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="UniParc:UPI000183077A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T0"
FT                   /transl_table=1
FT                   /translation="MSAAKTRAQSLINDNAVVVFSKSYCPYCDSSKKLLDSLNAKYTTL
FT                   ELDLEEEGAAIQSALAEISSQRTVPNIFINKKHIGGNSDLQGKKDLKDLLKEAGAI"
     atgtccgccg caaagacccg cgctcagtcc ctcattaacg acaacgctgt cgtcgttttc        60
     tccaagtcat actgccctta ctgtgactct tccaagaagc tgcttgacag cttgaatgcc       120
     aagtacacta ctctcgagct tgatctggag gaggaaggag ccgccatcca gagcgctctt       180
     gccgaaatct caagccagcg taccgtgccc aatatcttca tcaacaagaa gcacatcggc       240
     ggcaactccg acctccaggg caagaaggac ctgaaggacc tgctcaagga ggctggtgcc       300
     atctaa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page