(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE171

PENCW_10.PE171       Location/Qualifiers
FT   CDS_pept        join(397909..397920,397979..398050,398152..398205,
FT                   398355..398497,398559..398691)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129221"
FT                   /orf_name="Pc13g01710"
FT                   /product="Putative uncharacterized protein Pc13g01710 "
FT                   /protein_id="CAP91240.1"
FT                   /db_xref="UniParc:UPI000183077B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T1"
FT                   /transl_table=1
FT                   /translation="MDEMGGVRDDERIGGRFRQISGIERCDDLVAAKYILIYLTRRLVG
FT                   EADQTKERGEIASKKAWEYGKTGFKDVSERNPKIGEKKRNHRVKKVTGRFESLIPILSI
FT                   AIWSELFRIPSYHFGRKNNGHRRREEKYQGMDA"
     atggacgaaa tgggcggggt acgggacgat gagaggattg gtgggcgatt ccgtcagatt        60
     tcggggattg aacgctgcga tgatttggta gctgcaaagt acattttgat atatcttact       120
     aggcgcctgg ttggtgaggc agatcagacc aaagaaagag gagaaatagc tagcaaaaag       180
     gcttgggaat atgggaaaac aggcttcaaa gatgtttcag agagaaatcc aaagattgga       240
     gaaaagaaaa gaaatcatag ggttaagaaa gtcacaggaa ggttcgagtc cctcatcccc       300
     atcctatcca tcgcgatctg gagcgagctt tttagaatcc cctcctacca cttcggtagg       360
     aagaacaatg gtcacaggag aagagaagag aaatatcaag gaatggatgc atga             414
//

If you have problems or comments...

PBIL Back to PBIL home page