(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE174

PENCW_10.PE174       Location/Qualifiers
FT   CDS_pept        join(404979..405030,405216..405356,405459..405589)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949803"
FT                   /orf_name="Pc13g01740"
FT                   /product="Putative uncharacterized protein Pc13g01740 "
FT                   /protein_id="CAP91243.1"
FT                   /db_xref="UniParc:UPI000183083A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T4"
FT                   /transl_table=1
FT                   /translation="MEDDKPLAVTAIHVATPLWVTCTRRLCRLRHIACTQHFVVIANIY
FT                   APPALILLSGWMQLPVICQAYGCLVVGHATTDEKYRSDRNVIQPRYGPGAFCGVQTPCL
FT                   AVS"
     atggaggatg acaagccact agcagtgaca gctatccacg tcgccacccc tctgtgggtc        60
     acctgtactc gaaggctatg tcggcttaga catatagctt gcacccagca ttttgtagtg       120
     atagcaaaca tctatgctcc tcccgcgtta atcctgcttt ccgggtggat gcaactccct       180
     gtgatatgtc aagcctatgg ttgccttgtc gttggacatg caactacgga tgagaaatac       240
     aggagcgaca ggaatgtgat ccaaccccga tatggtccag gtgctttctg tggagtccaa       300
     acaccatgcc tcgctgtgtc ctag                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page