(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE175

PENCW_10.PE175       Location/Qualifiers
FT   CDS_pept        join(complement(409596..409903),complement(407803..409537))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210216" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978062"
FT                   /orf_name="Pc13g01750"
FT                   /product="Pc13g01750 protein"
FT                   /protein_id="CAP91244.1"
FT                   /db_xref="InterPro:IPR006876"
FT                   /db_xref="UniParc:UPI000183083B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T5"
FT                   /transl_table=1
FT                   /translation="MFPVSVSPISVGSNVFFAFALFLISALVLLLLRRFLTLRATPAYL
FT                   SVPIFLALALPASVVLLVPIDLASSSRDGSGPKAIWLPERMVLVCWRIAYWLIFVLTWV
FT                   ILPLLGEYVDSGYREPKGRLMYSLRSNAKYQLIVLGCALVGLVYVSISNGFEFRSIKGL
FT                   IMALAYVWGLVLAIYLMGHGLVSIPRNLLRNSNVSGRLRRLQAHAPRVHDRLMDSVNEL
FT                   ANLNSQVSQLQRRKTGTARDFQEWIEELREGHGQSDVRIPILESPDTSATIPSVITERY
FT                   LADLTRRLQRARHMKARFVDEWDRLVQLSADLQAIINSTASKKLEFAPAARRSSCIPRV
FT                   KFLNPYMRYQLYSNVIPSVRLAFGAFFAVASVCIVWSEMIKSLAPHLSAISLTVVPNWK
FT                   DSPVGFGGQLTASAWLLYMCSAALVGVSDVKVWGNRALVRRNTYGESACWYAGLVARLT
FT                   VPIAYNFLTFLPKDFRRSTTFYEFLGKLINLTPLGKGFDFIFPIFILLPICATLFNLYG
FT                   RIKNIFGCGLAEDDDIHDVENNPAGYGMGGWREGRDLIERELNGFGSLAVSSRGSRSTW
FT                   ASDRDDEGSPGSSRLRVPVAEGSQPAQRSVVAPTIVGGEEDDDENFFQSFAHRVKNTFD
FT                   TTNTPRWFQGEPFRLPRWMSGDNNTTEEGSALFGGRAVPGRLRLG"
     atgttccccg tatctgtgtc gcccatctcg gtgggctcga acgtcttttt cgcatttgcc        60
     ctgttcctca tctccgcact tgtgttactt ctactacgac gatttcttac cctccgcgcc       120
     acccctgcgt atttaagtgt ccctatattc ctggctctgg ctctgcccgc cagcgttgta       180
     ctcctcgtcc ccatcgattt ggcgtcaagc tcgcgagatg gatctggccc caaggcaatc       240
     tggctaccgg agcgaatggt tctggtatgc tggcgcattg cgtactggct aatcttcgtt       300
     ctcacctggg ttatcctccc attactcggt gaatacgtcg actcaggcta ccgtgagcca       360
     aagggccggc ttatgtactc ccttcgatcg aacgcgaaat atcagttaat tgtcctggga       420
     tgtgctctgg tggggttggt ctacgtatcg atctcaaacg ggttcgaatt cagatcaatc       480
     aaaggtctca tcatggcatt ggcatatgta tggggtctcg tccttgccat ttatctcatg       540
     ggccacggtc ttgtttccat cccgcgcaat ctgctccgaa actccaatgt gagcggtcgg       600
     ctacgcagac tccaggcaca tgcgccaagg gtgcatgatc gcctgatgga ctcagtcaat       660
     gagttagcga atctcaattc ccaggtttct cagctacagc gccgtaagac aggaactgct       720
     cgtgactttc aggaatggat tgaagagctt cgagaagggc atggccaatc cgacgtgcgg       780
     atcccgattc tcgagtcacc ggatacatcc gccacgatac cttctgtcat cacggaacgc       840
     tatctggccg acctcacgcg gcgacttcag cgtgctcgac atatgaaagc ccgatttgtg       900
     gatgagtggg atcgtctggt ccagttgtca gccgatctcc aggccatcat caattctaca       960
     gcttcaaaga agctcgaatt tgcaccggcc gcacgtcgat catcctgcat ccctcgtgtg      1020
     aaattcctca acccctacat gcgatatcag ctatattcca acgtcattcc gtcggtcagg      1080
     ctggcatttg gcgcgttctt cgcagtggcg tcagtctgca ttgtttggtc agaaatgatc      1140
     aagtccctgg cgccccatct ctccgccatt agtttgaccg tggtcccgaa ctggaaagac      1200
     agtccagttg gcttcggtgg gcagctcaca gcctctgcct ggctgctgta catgtgttcg      1260
     gcggctctgg ttggtgtcag tgatgttaag gtatggggaa atcgcgcgct tgtccgtcgt      1320
     aatacatatg gcgagagtgc gtgctggtac gctggtctcg tggctcggct gacggtacca      1380
     attgcgtaca acttcttgac ctttttacct aaagatttcc ggcggagcac cactttctac      1440
     gaattccttg gcaaactcat caacctaacg cctctcggga aaggatttga cttcatcttc      1500
     ccgatcttca tcctcctgcc tatctgcgca acattgttca acctatacgg gcgtatcaaa      1560
     aacatctttg ggtgcggcct cgcggaggac gatgatatcc acgacgtcga aaacaaccct      1620
     gccgggtatg gtatgggtgg ctggcgtgag ggccgcgacc tcattgaacg ggaattaaat      1680
     ggcttcggtt ctctggcagt gtcctcccgt ggtagtcgct caacatgggc ttcagatcgt      1740
     gacgatgaag gttccccagg gtcatccaga ctgcgggtcc cggttgcaga gggctctcag      1800
     cctgcccaga ggtcagttgt tgcgcctact attgtaggcg gggaggaaga tgatgatgaa      1860
     aacttcttcc agtcctttgc gcatcgtgtc aagaacacat ttgatactac gaacactcct      1920
     cggtggttcc agggtgagcc attccggctt ccgcgctgga tgtcgggtga taacaatacc      1980
     acagaagaag gttcggcgct gtttggaggc cgggctgtgc ctggtcgtct gcgcctgggt      2040
     taa                                                                    2043
//

If you have problems or comments...

PBIL Back to PBIL home page