(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE176

PENCW_10.PE176       Location/Qualifiers
FT   CDS_pept        join(complement(411465..411494),complement(411300..411386),
FT                   complement(410897..411250),complement(410604..410666),
FT                   complement(410154..410276))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129223"
FT                   /orf_name="Pc13g01760"
FT                   /product="Putative uncharacterized protein Pc13g01760 "
FT                   /protein_id="CAP91245.1"
FT                   /db_xref="UniParc:UPI000183083C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T7"
FT                   /transl_table=1
FT                   /translation="MGDQWAIRAEEVQHGLISGREKKGKQVLVWNRDSSRSGRGTNTNT
FT                   DQHNEESKAFGQQRQMNSIRWPPPDCGLERMKTVVGWIGSVTGIMQPSSRTGPQLLSSL
FT                   HNGETIGGLKDKEHRYLRKIRMTLRQRQMSAQISLSWGAQSKKKWRSSEGYYDGGHKAS
FT                   SEVLPVLPGFPLLGQFSSRSTRRSGPDLIRRNQLVKMPETLPGGCGRVPGTPLYT"
     atgggggatc aatgggcaat ccgcgcagag gaagttcaac acgggttgat cagcgggagg        60
     gaaaaaaaag gtaagcaggt gctggtgtgg aaccgtgatt cgagtcgatc agggagggga       120
     accaacacca acaccgacca acacaacgag gagagcaagg cgttcgggca gcagcgtcag       180
     atgaattcaa ttcgctggcc accacctgat tgtggcttgg agcgaatgaa aacagttgta       240
     gggtggatag gatccgtgac agggatcatg cagccctcaa gtcgcaccgg gcctcagttg       300
     ctgtcctctc tgcacaatgg cgagacgatt gggggtttga aagataaaga acacaggtac       360
     ttacggaaaa tcagaatgac actgagacaa agacagatga gtgcacagat ctcgttgagt       420
     tggggggcgc aaagcaagaa gaagtggcgg tcgagtgaag gatattatga tggcggtcac       480
     aaggctagtt ctgaggtact tccagttttg cctgggtttc cactacttgg ccagttctca       540
     tcaagatcga caaggcgttc tggccctgac ctgatccgga ggaaccaatt ggtcaaaatg       600
     ccagaaacac tgccaggagg ctgcggccgg gtaccaggta ctccactata cacctga          657
//

If you have problems or comments...

PBIL Back to PBIL home page