(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE177

PENCW_10.PE177       Location/Qualifiers
FT   CDS_pept        join(411592..411725,411803..414686,414741..416087)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210228" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949804"
FT                   /orf_name="Pc13g01770"
FT                   /product="Pc13g01770 protein"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAP91246.1"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="InterPro:IPR008626"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000183083D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1T8"
FT                   /transl_table=1
FT                   /translation="MQVPKNDSVQSMMTYVAQMLQNQGPFQGWKADVLIKTRATNVYQM
FT                   ITSLRLIQPRIDLHQAAQAAMSFELKAFTKANEKIEYEKECTEKLLHIRNTRERQAAVA
FT                   YQSGMMPQTGAGPNQIPAAFPQHIPVSGQQQLAMGMNGQNQQAALQRQQQQQQSHAMLQ
FT                   QQQQQQQQQQQQQQQQQQRSQQRPGNGIPMVDDLSTLSAQDLDHVSRLANEMLNKTNPE
FT                   DMEKIKMNLSNMTPEQRQYLARKNLEPMTYFFRSQALNQIRRHRRARLEMGGRAPNPGV
FT                   DANGNMMGDPMMNSQHQRQMLQNMLNLQRNSAFPGNPGQTMDPPNFIGNVENIQGQQAD
FT                   GLRSQEAGQLVVPASSSQMNQAPFPNNNNNMFPQQMGQNGQANMNANNPNAQAQFLAQQ
FT                   HLQGGSNTPQDRLQFQAQQSQAQAQAQARVQAAQKAQMAMSGHGGQVTPQSQPQLNGQS
FT                   PVMPMLNQPMAPGQMSPVQVPAQARPPSRPANMGQHPAGVAGQAAMQGPLQIPSNIPPH
FT                   IQEQLARMPPEQARAFIMQQQRRAALNNMARANPGQQPQPQPGQAQSMMNNQMGNAIMR
FT                   GSMSGPQDLNSGGMPQGQQMTQQQRQQRQNELYKLQLLRQQNNGVEMTPEQGKQMDRVS
FT                   FPPSILNMNGTSMQVPSNIKSWGQLKQWANSNPQIASPNDLPRLMMLQKLHLGQLISAS
FT                   TNQPKDQNGQGPAATPFQGTQVPFNNAPGFLPGQQPGAMNMAAMRPITAQDIQMARQKL
FT                   GHQASNFTDEQIREILLRNRQKQMMQAAQNRAMQLEGNTQAGQLSQPATQPPVPTAQPV
FT                   PQIKPQNAQPPQSTPQAANAKAQTGAATKGAKGATGKQASKKRPSTDDTTEARATATPQ
FT                   MNQPVAVPGGPATAPQRPAFPFTQEQLAQMTPQQRAQVEAHMRSKQPQSRGQVLSRAAA
FT                   EEAWNRNLPPQVMEVYNDIAKNAPPAKPIPVSPEQKAAMTKQLREAVEVLGRLDALVQW
FT                   FAKMQGQEKNVKNLLAMRIQLMRQFKPSQEWGVNEQFTVTPDYLTGAILFMRKLFAVMI
FT                   SRMQQGQRPTSQAPSSNGQQMPGNMPALNATNLQQLQAQEEALQRARRASSQSAANAPA
FT                   APFAAPSPRGVPQYAAGGLAPENLKLPPPKKRKQSHGVASSPVQATAPPGAAAKYNKAV
FT                   ADATSNAAAMAGAFKCSVVECQHHYQGFPTQAVLDKHVEESHQPEEEETIEDPLKYYHE
FT                   SISMGLGLNSDDSPETQQMATLGPVPSSTKPSAAASPAKQGVSTPLIANNTPMARVTSQ
FT                   FGGKTASPAAASTQLLTPQLSSVKGSKPADKDGKKDAIKLEDSDTKDPWAECPTSLDTI
FT                   HDTFSNLASKDLPHLGYDSLEDFDINEATPVDDDWAAFASLTPPNEAEEAAFLEKFYEP
FT                   WDEDSIARAADWMRIPPEIQVKGIGPMGQLEVDWDAVARYEREGIRIRQTSK"
     atgcaggtcc caaagaacga cagtgtgcaa tctatgatga cctatgttgc gcaaatgttg        60
     caaaaccagg gaccatttca aggttggaag gcagacgttc taatcaagac tcgggcaacg       120
     aatgtttatc agatgatcac ctccctccgt ttgatccagc ctcgcatcga cctccaccag       180
     gcggcccagg cggccatgag tttcgaatta aaagcattca ccaaagccaa cgagaagatt       240
     gaatacgaga aagaatgcac cgagaagctt cttcacatca gaaacacccg agagagacag       300
     gccgcggtcg cttatcaaag tggaatgatg ccccagacgg gcgctggccc aaatcagatc       360
     ccagccgctt ttccgcagca catcccggtt tctggccaac agcaactggc aatgggaatg       420
     aatgggcaga accagcaggc agccctacag cgacaacagc agcagcagca gtctcatgcg       480
     atgctccaac agcagcaaca gcagcaacaa caacagcagc agcagcaaca gcagcagcaa       540
     cagcggtccc aacagcgccc gggcaatgga attccgatgg tcgacgacct cagcacgctt       600
     tccgcccaag atcttgatca cgtctctcga ctggcaaacg agatgttgaa taaaaccaac       660
     ccggaagata tggagaagat caagatgaac ttgtcaaaca tgacacccga gcagcggcaa       720
     tatttggcac ggaagaacct tgagccaatg acttattttt tccgctctca ggctttgaac       780
     cagatcagac gccatcgtcg cgctcgtctg gaaatggggg gacgtgcgcc aaatcccggg       840
     gtggatgcga atggtaacat gatgggggat cccatgatga attctcagca ccagcgacag       900
     atgcttcaaa acatgttaaa ccttcagcgc aattccgcat tccccggaaa tcccggtcag       960
     accatggatc ccccaaactt cattggaaat gtggaaaaca tccaaggaca gcaagcagat      1020
     ggcctgcgct cacaggaggc tggtcagcta gtcgttcctg caagctcttc ccaaatgaac      1080
     caagccccat tcccgaataa taacaacaac atgttcccac agcagatggg ccagaatggc      1140
     caggcgaata tgaacgccaa taatccaaac gcccaagccc agttccttgc ccagcagcat      1200
     ctgcagggag ggtctaacac tccccaggat cgattgcagt tccaggcaca acagtctcag      1260
     gctcaagccc aggctcaggc gcgtgtgcaa gcggcgcaaa aggctcagat ggcgatgtcg      1320
     ggccatggcg gccaagtgac cccccaatca cagccgcaac tgaacggaca gagccccgtc      1380
     atgccaatgc tgaatcaacc catggcaccg ggtcagatgt ccccggtcca ggttcccgct      1440
     caagcccgac cgccgtcccg gcctgcaaac atgggccagc atccggctgg cgttgcagga      1500
     caggctgcga tgcaaggtcc actccaaatt ccttccaata tcccgcctca catccaggag      1560
     caactcgctc gcatgcctcc tgaacaagct cgggctttta tcatgcagca acaacgtcgt      1620
     gccgctctaa acaacatggc tcgggccaac cccggtcagc agccgcagcc tcaacctggc      1680
     caagcccaat caatgatgaa taaccagatg ggcaacgcca taatgagagg atcgatgagt      1740
     ggcccacagg atttgaactc gggaggcatg ccccaaggcc agcaaatgac ccagcagcaa      1800
     cgtcaacaac gccagaatga gctttacaag ctccaactgc tgcggcagca aaacaatggc      1860
     gtggaaatga ctcctgagca gggaaagcaa atggaccgcg tgtctttccc accgtctatt      1920
     ctgaacatga atggcacctc gatgcaagtc cctagcaaca tcaaatcatg gggccagctc      1980
     aagcaatggg caaattcgaa ccctcaaatt gcaagcccca acgacctccc gcgcctcatg      2040
     atgctccaga aacttcatct tggtcaactg atctcagctt ccacgaatca accgaaagac      2100
     cagaatggcc aaggtccggc ggcaactcca ttccaaggca cccaggttcc gtttaacaac      2160
     gcgccaggct tccttcctgg ccaacaacca ggtgctatga atatggcggc catgcggcca      2220
     atcaccgccc aagacatcca aatggctcgt caaaagcttg ggcaccaggc atcaaacttc      2280
     accgacgagc agattcggga aattctgttg cgaaaccgcc aaaagcaaat gatgcaggct      2340
     gcacagaacc gagcaatgca acttgaagga aacacgcaag ctggccagct aagtcaaccg      2400
     gcgacgcaac ccccagttcc tacagcacag cctgtcccgc aaatcaagcc gcagaatgcc      2460
     caacccccac aatcgacccc tcaagcggcg aacgcaaagg ctcaaactgg agccgcgacc      2520
     aaaggtgcta agggcgctac cgggaagcag gcctcgaaga agaggccaag cacagatgat      2580
     acaacagaag cccgagccac agctacaccc caaatgaacc agcctgtggc agttccgggc      2640
     ggaccagcga cagcgcccca acgcccggct ttccctttca cgcaggaaca gcttgcacag      2700
     atgactcctc aacagcgagc tcaggttgaa gcacacatgc ggagcaaaca gcctcaaagt      2760
     cggggtcagg tactcagtag agctgccgcc gaagaggcat ggaacaggaa cctaccaccg      2820
     caagttatgg aggtttacaa tgatatcgcc aagaacgctc cacccgcaaa gcccatacct      2880
     gtctcgccag agcagaaggc cgctatgacc aaacaactgc gtgaagccgt ggaagttctc      2940
     ggccgcttgg acgcccttgt acagtggttt gcaaagatgc aaggccagga gaagaatgtg      3000
     aagaatcttc ttgccatgcg aatccaattg atgaggcaat tcaagccctc gcaggagtgg      3060
     ggagtgaatg aacaattcac ggttacgccc gattatctca ctggtgccat ccttttcatg      3120
     cggaagttgt ttgcagtgat gatttctcgc atgcaacaag gccagcgtcc tacctcccaa      3180
     gctcctagct ctaatggcca gcaaatgcca ggcaacatgc cagcactgaa cgcgaccaat      3240
     ttgcagcagt tgcaggcaca ggaagaagcc ctacaacgag ctcggcgcgc ctctagccag      3300
     tctgctgcaa atgccccagc tgcacctttc gcggctccgt ctcccagagg cgtccctcaa      3360
     tatgccgcag gcggacttgc cccggagaat cttaaactgc ctcctcccaa aaagcgaaag      3420
     cagtctcacg gtgtggcatc atccccggtt caggcaactg cacctcctgg cgcagcggca      3480
     aaatacaaca aagcggtggc agacgccaca tccaatgcag cagccatggc aggtgctttc      3540
     aaatgcagtg tggttgagtg tcaacaccac taccaaggat tcccgaccca agccgtcttg      3600
     gacaagcacg ttgaagaaag ccaccaaccc gaggaggaag agacgatcga agaccctctc      3660
     aaatattacc atgaaagtat ttcgatgggt cttggactga actctgatga tagtccggaa      3720
     acccagcaga tggccacact cggaccagtg ccatcctcca ccaagccaag tgcagcagct      3780
     tcccccgcga aacaaggtgt ttctacccct ctcattgcca acaacacacc catggcaagg      3840
     gtcactagcc aattcggtgg caagaccgcg tctcctgctg cagcatcgac ccaactgctc      3900
     actccgcagt tgtcttctgt caagggatcg aagcctgctg acaaggacgg gaagaaggat      3960
     gctattaaac tggaggatag cgacacaaag gatccctggg cggagtgtcc cacctcgctt      4020
     gacacaatcc atgatacatt ttcaaacctc gcgagcaaag atctccctca cctgggctat      4080
     gattcgcttg aggacttcga tatcaatgaa gctaccccgg tggatgatga ctgggctgcc      4140
     tttgctagtc tgactcctcc aaacgaggct gaggaggctg ctttcctgga gaaattttac      4200
     gaaccctggg acgaagactc cattgcaagg gctgcagatt ggatgcgcat tccgcctgag      4260
     atccaggtca agggcatcgg acctatgggc cagcttgagg ttgattggga tgcagttgcg      4320
     cgttacgaga gagaaggcat ccgcatccgc cagacttcca agtga                      4365
//

If you have problems or comments...

PBIL Back to PBIL home page