(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE179

PENCW_10.PE179       Location/Qualifiers
FT   CDS_pept        join(complement(421451..421596),complement(421206..421394),
FT                   complement(419021..421154),complement(418852..418947))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210271" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949806"
FT                   /orf_name="Pc13g01790"
FT                   /product="Pc13g01790 protein"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="Golgi apparatus part"
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="CAP91248.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="GO:0044431"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR008153"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017107"
FT                   /db_xref="UniParc:UPI000183083F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U0"
FT                   /transl_table=1
FT                   /translation="MQSNISTVKQFIRNVRSAKTIADERAVIQKESAAIRASFREESHD
FT                   SGIRRNNVAKLLYLFTLGERTHFGQIECLKLLASHRFADKRLGYLGTMLLLDENQEVLT
FT                   LVTNSLKNDLNHSNQYIVGLALCTLGNIASVEMSRDLFPEVESLMSTANPYIRRKAAIC
FT                   AMRICRKVPDLYEHFLEKAKNLLSDRNHGVLLCGLTLAIDLCEAEEEEEEEEEGGPVGV
FT                   IEMFRPLAGGLVRALKGLTTSGYAPEHDVSGITDPFLQVKILRFLRVLGRGDVATSELI
FT                   NDILAQVATNTDSSKNVGNSILYEAVLTILDIEADSGLRVLGVNILGKFLANKDNNIRY
FT                   VALNTLNKVVAIEPNAVQRHRNTILECLRDPDISIRRRALDLSFMLINEDNVRVLVREL
FT                   LAFLEVADNEFKSVMTTQIGIAADRFAPNKRWHMDTILRVLKLAGNYVKEQILSSFVRL
FT                   IATTPDLQTYAVQKLYSSLKEDISQEGLTLAATWTIGEYADSLLQGGQYEEEELVKEVR
FT                   ESDIVDLFTNILNSTYASQIAVEYIITASMKLTVRMSDPAQIERLRRLLSSRTADLSVE
FT                   IQQRAVEYTNLFGYDQIRRGVLERMPPPEIREEQRVLGAAPAAKKRQSKLLRGKSTTKV
FT                   AKPAEHDLLLDLVGGSDAPVTSPTSGGSNTADLLADILGGDSGMSSPSPGPAGQKNAIM
FT                   DLFGSNGPSPSPQPTQPTSASMDLLGAGGMGVSAPSPTTSPAPVTASTPAHTALNKDGL
FT                   VLTLQVQRSGNIAQILARFRNDSNFDRFTSVGLQAAVPKSQRLQLSAITKADLEAGDEG
FT                   TQSLRVTALNGGLPAKLRLRLRVTCARDGGNPVTDQVDWSEP"
     atgcaatcca atatatctac agtcaaacaa ttcattcgta atgtccgatc cgcaaagacc        60
     atcgccgatg aacgtgcagt tatccaaaaa gaaagcgccg ctattcgcgc ctcgtttcgc       120
     gaagagagcc acgactccgg catccggaga aataatgtcg ccaagctctt gtatctgttt       180
     actctcggag agcgaactca cttcggccaa atcgaatgcc tgaaactact cgcctcacac       240
     cgattcgccg acaagcggtt ggggtatctg gggaccatgc tgttgctaga tgagaatcaa       300
     gaagtgctaa cactggtgac caattctttg aaaaatgacc ttaatcactc caaccaatat       360
     atcgtcggtc tcgccctctg tacactcgga aatattgcct cggttgaaat gtcccgtgat       420
     ctgttccccg aagtcgaaag ccttatgtcg accgccaacc cctatattcg acggaaagcc       480
     gcgatctgtg ccatgcggat atgtcgcaag gttccagacc tgtacgagca cttccttgag       540
     aaagctaaga acctgctgtc ggaccggaac catggcgttc ttctctgcgg actgacacta       600
     gcgattgatc tatgtgaagc ggaagaggag gaggaggagg aggaggaagg aggaccagtg       660
     ggcgtgatcg aaatgttccg gccgttggct ggaggactgg ttcgcgcctt gaaggggctg       720
     acaacctccg ggtatgcccc cgagcatgat gtgtctggta tcaccgatcc tttccttcag       780
     gtcaagatcc ttcggttctt gcgtgtattg ggccggggag atgtggccac tagcgaattg       840
     atcaacgaca tcctggccca ggtggccacc aacacggatt cctcgaagaa tgtcggcaac       900
     tctattctat atgaggccgt tcttacaatt ctggatattg aagctgactc tggcctgagg       960
     gtgctgggcg tcaacattct cggcaaattc ctggctaaca aggacaataa tatccgctat      1020
     gttgcgttga acaccctgaa taaggttgtt gcaattgaac caaatgcagt gcagagacat      1080
     cgcaacacga tcttggaatg cctgcgggat cctgatatta gcattcgccg gcgagcgctc      1140
     gatctcagct tcatgttaat caacgaagat aatgtgcggg tgctggtgcg ggaactgctg      1200
     gccttcctgg aggtagccga caacgaattc aagtccgtca tgacaacaca gataggtatc      1260
     gcggccgatc ggttcgcacc caacaagcgc tggcacatgg acaccattct gcgggttctc      1320
     aagctggctg ggaactatgt caaagaacag atcctgtcct cgttcgtccg tctcattgcg      1380
     accacccctg atctgcagac ctatgcggta caaaagctct actcgtcatt gaaggaggac      1440
     atctcacaag agggtctcac actggctgcg acgtggacca ttggtgaata tgccgatagt      1500
     ctccttcagg gtggtcagta tgaggaggag gaattggtca aggaggttcg ggagagtgat      1560
     atcgttgacc tctttaccaa cattcttaac agcacctatg cctcccagat tgctgtcgaa      1620
     tacatcatca ctgcatccat gaagcttact gtgcgcatgt cggatcctgc tcaaattgaa      1680
     cgcctacgcc gtctgctttc cagccgaacg gcggatctca gtgtcgaaat tcaacagcgt      1740
     gctgttgaat acaccaacct tttcggttat gatcaaattc gccgtggcgt gctcgaacga      1800
     atgcccccgc ctgagatccg tgaggagcag cgggtactag gtgctgcccc cgctgctaag      1860
     aagcgtcaga gtaagcttct ccgtgggaag tcgacgacaa aggttgccaa acctgcagag      1920
     catgacctgc tccttgacct ggttggtgga tccgacgccc ctgtcacgag ccctacctcg      1980
     ggcggatcaa acaccgccga tctgctggca gacattcttg gcggagactc aggcatgtcg      2040
     tctccgtcgc cgggacctgc tggccaaaag aacgccatca tggacttgtt tggctccaac      2100
     ggtccttcac catccccgca gcccacacaa cccacatccg cctcgatgga tctgctaggt      2160
     gcaggaggca tgggtgtctc agcgccttcg cccaccacct ctcccgcgcc tgtcaccgct      2220
     tcgacccctg cgcacaccgc gctcaacaag gacggcctcg tccttacctt gcaggttcag      2280
     cggagcggca acatcgccca gatactggcc cgtttccgca acgactccaa cttcgaccga      2340
     ttcacaagcg tcggcctgca agctgccgtg ccaaagagcc agcggttgca gctgagcgca      2400
     atcaccaagg ccgatctaga agccggcgac gagggcacac agtcactccg tgtgaccgct      2460
     ctgaatgggg gtcttcctgc caaacttcgt ctccgtcttc gtgtcacttg cgcccgcgat      2520
     ggtggaaacc ctgtcaccga ccaagtggac tggtccgagc cgtag                      2565
//

If you have problems or comments...

PBIL Back to PBIL home page