(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE18

PENCW_10.PE18        Location/Qualifiers
FT   CDS_pept        join(38747..39148,39205..40218,40283..40510)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671649"
FT                   /orf_name="Pc13g00180"
FT                   /product="Pc13g00180 protein"
FT                   /protein_id="CAP91087.1"
FT                   /db_xref="UniParc:UPI0001830D04"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G7"
FT                   /transl_table=1
FT                   /translation="MASGLEVVGLALAVFPILVEGLKFYADKKGRVRDFIHYRHLLKRI
FT                   VRDLSREQISFQNSSQLFLENISMHYGLSSNDIQEMMQNPQDARWRKGIPFQSDYLIEK
FT                   SVAIYLETVEDMNEVLIKIQDTVGTREGAHPALLDKSTFRRQWRKITLVLGEEDIKKHL
FT                   ERARGLNTFLSQLTEQNKPTSLADSVLQRSTLHYERIRRHAIELFEIFQANLSTSVICK
FT                   CVLGHTVNMKLEFRSARITAKRLFFRTLFTFDRAEPNLTPPYNWREVEIEPLLSARLCH
FT                   ETISHKAVNLFADSSTVQTADSTSSELPNICTVIKGPIQSGWLGYLANSQGCRHRIRVL
FT                   ALDQISAALETIQTISLAAVLDHREFRLVHRYRLGLKLASSVMQLHTTQWLPDYWNKSD
FT                   ISFPCFSDGKIDFNNPLIKRGFGSEEKQNSMAFTSGLSNCGSVPCLFSLGVVLLELIER
FT                   QSIETMKNNSYDDSNTGQVTVELTKRLANSTDCSPNYKKVMKRCIGGLDAAFESLEDGD
FT                   FRDEVEQKIILPLEEDLKFYCDKGYIEDCV"
     atggcttccg gactcgaggt tgtggggcta gctctggcgg ttttccctat tcttgtggaa        60
     gggctcaagt tctatgcgga caagaaaggt cgagtacgag attttattca ttaccgacat       120
     ttactcaaac gcattgtccg cgacctctcc cgcgagcaga tcagcttcca aaactccagc       180
     caacttttcc tagaaaatat ttccatgcac tacggtctta gctcgaacga tatccaagaa       240
     atgatgcaaa atccacagga cgcccgttgg cgcaagggaa tcccatttca gagcgactac       300
     ctcatagaaa agtcggtcgc tatttatctg gagacagtgg aagatatgaa tgaagtatta       360
     attaagatcc aagacacggt ggggactcgt gagggtgccc atcccgctct actagacaaa       420
     tccacttttc gcagacagtg gaggaaaatc acgctagtcc taggcgaaga agatatcaaa       480
     aagcatctcg agcgtgcacg tgggctaaat accttcctgt ctcagcttac agaacaaaat       540
     aaacccacat ctttagcaga tagtgttttg caaagaagca ctctgcacta tgaacgaata       600
     cggagacacg ctatcgagct ttttgaaatc tttcaagcca atctttcgac ctcagtgatc       660
     tgcaaatgcg ttctcgggca cacagtcaac atgaaactcg aattccgtag cgcacgcatc       720
     acagcgaaga ggcttttttt ccgcacgctt ttcactttcg accgtgccga gcccaatttg       780
     acacctccgt ataactggcg ggaagtagag atagagcctc tgctatctgc tcggctttgt       840
     catgagacaa tatctcacaa ggcagtgaac cttttcgcag attcatccac cgtccaaaca       900
     gcagactcaa cttcctcaga actaccaaac atttgcactg tcatcaaagg cccaatccaa       960
     tcaggatggc taggctatct ggctaatagc caaggctgcc ggcatcgtat ccgtgttcta      1020
     gcattggatc aaatttcagc agctttagag accatacaaa caatttccct tgctgcagtt      1080
     cttgaccaca gagaattccg cctagtacac agatatcgac tcgggcttaa gcttgcctct      1140
     tctgtaatgc agcttcacac aacccaatgg cttccggact attggaacaa gtctgatatc      1200
     tctttcccat gcttttcgga tgggaaaatt gattttaaca acccattgat taagcgtggc      1260
     ttcggatctg aagaaaagca aaactcaatg gcctttacct caggattaag caattgtgga      1320
     tctgttcctt gtctgttctc tcttggggtt gtgttgctgg aattgatcga acggcaatca      1380
     attgaaacta tgaagaataa ctcatatgac gactcgaata caggacaagt gaccgttgag      1440
     ttgacgaagc gactagctaa ttccactgat tgcagcccta attacaagaa ggtcatgaaa      1500
     agatgcatag gcggcttgga tgctgctttt gaatcactag aagatggcga tttcagggat      1560
     gaggtggaac agaagataat tctaccactg gaggaagacc tgaaatttta ctgtgataag      1620
     ggctacattg aagattgcgt gtga                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page