(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE182

PENCW_10.PE182       Location/Qualifiers
FT   CDS_pept        425534..426013
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949808"
FT                   /orf_name="Pc13g01820"
FT                   /product="Putative uncharacterized protein Pc13g01820 "
FT                   /function="D-arabinono-1,4-lactone oxidase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP91251.1"
FT                   /db_xref="GO:0003885"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="UniParc:UPI0001830841"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U2"
FT                   /transl_table=1
FT                   /translation="MGQFEHFFPIENLTEAGKGYFNYALCQSDRMRPYQLDNPIEEGLR
FT                   GVYLSDDVTVNLLANASGIFATLEYSWIPSYNNYTLQWFYQDLLEEIFLIFGEKYNVRP
FT                   HWNKMLFNDGTYASNIYPKINSWLDIQEQMDPHCQFVNEFLAESLGIERCVSLFQ"
     atgggccaat ttgagcactt cttccccatt gagaacttga ccgaagctgg caagggttac        60
     ttcaactacg ccctgtgcca gtctgatcgt atgaggcctt accaacttga taaccctatc       120
     gaggaaggcc tgcgcggggt ttatttgagt gacgatgtta cggtcaacct gctggctaac       180
     gcaagtggta ttttcgccac actggagtac tcctggattc cgagctacaa caattacacc       240
     cttcagtggt tctaccaaga ccttttggaa gaaatctttc tcatattcgg tgaaaaatac       300
     aatgttcgcc ctcattggaa taagatgtta ttcaacgacg ggacttacgc ttcgaatatc       360
     taccccaaga tcaacagctg gctcgatatt caggagcaga tggacccgca ctgccagttt       420
     gttaatgagt tcctggctga gtcccttgga attgagcgat gcgtgtccct cttccaatag       480
//

If you have problems or comments...

PBIL Back to PBIL home page