(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE183

PENCW_10.PE183       Location/Qualifiers
FT   CDS_pept        join(complement(428571..428845),complement(427238..428495))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210272" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978063"
FT                   /orf_name="Pc13g01830"
FT                   /product="Pc13g01830 protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAP91252.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI0001830842"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U3"
FT                   /transl_table=1
FT                   /translation="MSTPPDIDPYAVLGVAKEATIPEIRAAHRKRVLKCHPDKIQDESQ
FT                   RIAAQDEFQKVQQAYELLSDDVRRTKHDQKVKIAELKRELLERRRTEVPMEVFFEEAMR
FT                   FTDEPRTMSRKFEDFGVRSKSKPTEEKKKARAPTSTYHQAKEKRETAKATHSDRAKTRD
FT                   QERRRQRQAEAKYDSTFDVCAESDDASDSSVPRYAHKRTSTPRRERERDSRSRPSESSR
FT                   RRERRYDEDDDISDHWQSKIESQYFNAEDYIASKTRKSKSPRRYHGHDSAEPESSTSRS
FT                   AGRSTRTRRRSSSRDRSYEHLESPRAYEVKPPKMQPSATSPGIKVPLRPSFLNTRAATS
FT                   SGFRQKRESRDSTLYEMAHEPLPSRTSKMRDRNDSGYSSPGTPEMLPRGTSPKTLYTVV
FT                   QEADHVVVEPKSSKYRSARSPDRDRVPSTRQVPKRSSTFQAYTEAAPRVETRSARPSSR
FT                   THPVEYITTAPKGNVKYGRTYKPEDVSYSPRRDYYYDEEYRPPAVGRRQSAY"
     atgtccacac caccagatat agacccatac gcagtacttg gtgtcgccaa ggaggccact        60
     atccctgaaa tcagggccgc ccaccgaaag cgggttctca agtgccatcc ggacaagatc       120
     caagatgagt cgcagcggat tgccgcccaa gatgaattcc agaaagtcca acaagcctat       180
     gaacttctct cggatgatgt ccgacggact aaacatgacc aaaaagtcaa gatagccgaa       240
     ctgaagcgtg aactactgga acgcagacga acagaagtcc cgatggaagt cttctttgag       300
     gaagcaatgc gattcacgga cgaaccacgc actatgtctc gcaaattcga agattttggc       360
     gtgcgctcaa agtcgaaacc gacagaggag aagaagaagg ctcgagcacc gacgagtaca       420
     tatcaccaag cgaaggaaaa gcgggagacg gccaaggcga cacattccga ccgcgcaaag       480
     acccgcgatc aggagcgacg acgacagcga caggccgagg caaagtacga cagtactttc       540
     gatgtctgtg cagaatccga cgatgcatct gattccagtg tcccccgcta cgctcacaaa       600
     cgaacttcaa ctccccgccg agagcgtgag cgtgattcac gatcccgacc atcagaatcc       660
     tctcgtcgcc gtgaacgccg ctacgacgaa gatgacgata tctccgatca ctggcaatcc       720
     aagatcgaga gtcagtactt caatgcagag gattatatcg catccaaaac ccggaagtcc       780
     aagtccccac gacggtacca tggtcacgac tcggcggaac cagagtcgtc cacttcgcga       840
     tccgcgggac ggtccacccg cacccgtcgt cgttcttcgt cgcgcgacag atcctacgag       900
     cacctagagt cgccccgagc ctacgaggtc aagccaccca agatgcaacc ctctgcaacc       960
     tccccgggta tcaaggtgcc tctccgccct tcgttcctca acacccgtgc cgcaaccagc      1020
     tctggcttcc gccagaagcg ggagagccgc gactcaacac tctacgaaat ggcccacgag      1080
     ccactgccat cgcgaacctc caaaatgcgc gatcgcaacg actccggcta ctccagtccc      1140
     ggtacccctg aaatgctccc gaggggcacc tctcccaaga ccctctacac ggtcgtccag      1200
     gaggcagacc acgtcgtcgt agaaccgaag tcgtcaaagt accgctcggc gaggtccccc      1260
     gaccgggatc gcgtaccctc tacacgacag gtgcccaaga gaagcagtac cttccaagcc      1320
     tacaccgaag ccgcgcctcg ggttgagact cggtctgcgc gcccttcttc tcgaacccat      1380
     ccggtcgaat acatcactac tgctccgaaa gggaacgtta aatacggccg gacatacaag      1440
     ccagaagatg tcagttactc gccgagacgc gactattact acgatgaaga atatcgtcct      1500
     cctgctgtgg ggagacgcca gtctgcctat taa                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page