(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE184

PENCW_10.PE184       Location/Qualifiers
FT   CDS_pept        join(430311..430393,430474..430549,430684..430770,
FT                   430841..430921)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129224"
FT                   /orf_name="Pc13g01840"
FT                   /product="Putative uncharacterized protein Pc13g01840 "
FT                   /protein_id="CAP91253.1"
FT                   /db_xref="UniParc:UPI0001830843"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U4"
FT                   /transl_table=1
FT                   /translation="MLNGAACASPDHDESIGKSANAERVNAVLPVILLFCVKVSYVLAQ
FT                   EWPTIHSNAIIALDHSHSFQPDCASRIHNPPIPSVVLLPLFPDSHANPARTGLGWIHNW
FT                   TLAA"
     atgctgaatg gagctgcgtg tgccagcccc gatcatgacg agtctattgg aaaaagtgca        60
     aatgccgagc gagttaacgc cgtactgcca gttatcttgc tattctgtgt taaggtgtcc       120
     tatgtcttag cgcaagaatg gcctacgatc cattcaaatg cgataatagc actagatcac       180
     tcgcactctt tccaacccga ctgcgccagc cgaatccata atcctccgat cccatcagtt       240
     gtgctcctac ccctcttccc tgacagtcac gccaaccccg ctaggactgg gcttgggtgg       300
     attcataatt ggacattggc agcctag                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page