(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE185

PENCW_10.PE185       Location/Qualifiers
FT   CDS_pept        join(431451..431615,431687..431737,431858..431953)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949809"
FT                   /orf_name="Pc13g01850"
FT                   /product="Putative uncharacterized protein Pc13g01850 "
FT                   /protein_id="CAP91254.1"
FT                   /db_xref="UniParc:UPI0001830844"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A5"
FT                   /transl_table=1
FT                   /translation="MAGRAIYWLAQRFVLFTAENSATGRSFGSAALSGSFEFGEIPVAD
FT                   DLRTSYWELTMGLYIACGVYSGHETRGYGAYARVALTPGLSDGFNYHPRGQRGAQFKK"
     atggcgggaa gagccattta ttggttggcc cagaggtttg tgctctttac ggccgagaat        60
     tcggccactg gcaggtcgtt tggaagcgct gcactttctg gaagttttga gtttggggag       120
     atccccgttg cagatgactt gcgtacatct tactgggaac ttacgatggg tttgtacatt       180
     gcatgcgggg tatactccgg acatgagaca agagggtatg gagcttatgc tcgagttgca       240
     ttgactccgg ggctgtccga cgggttcaat taccaccccc ggggccaacg cggcgcacag       300
     ttcaagaaat ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page