(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE186

PENCW_10.PE186       Location/Qualifiers
FT   CDS_pept        join(complement(433317..433512),complement(432227..433170))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210283" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949810"
FT                   /orf_name="Pc13g01860"
FT                   /product="Pc13g01860 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP91255.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI0001830845"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A6"
FT                   /transl_table=1
FT                   /translation="MRQKTRFVCVSDTHGYTPSETGFKLPAGDVLIHAGDLTNNGSLKE
FT                   LCRTMDWICKADFEIKIIVGGNHDVTLDQAFYREHGARFHGQHLEDSYHCLNLIMESPS
FT                   VVLLRHEPALIRLTRADGPNTVFKIFGSPYSQSPGNWAFGYESNDAAALWAQIPIDTDI
FT                   VVTHTPPQSHCDQKPNGMFVGCAALRSALSLIRPHLAVCGHVHEGRGYERVRWRGNLIN
FT                   TEIETETGPESDSVDHVTRGVLPPMGSKKQSLVDLTGKRDKRLDNEGFSHPRPRQHDLT
FT                   ETQPISSASPGSESSAGVPEKASQRNSPSTHPSLGAGSPGPNSRGFDYALQTLRKETCI
FT                   VNAAIMSTSWPHQGGKRFNSPIVVDLELPVWQNHAVANG"
     atgcgacaaa agacgcgttt tgtctgcgtc tctgatacac acggatatac gccctccgaa        60
     acgggcttca aactaccagc aggagatgtc ctgatccacg ccggcgactt gacaaacaat       120
     ggaagcctaa aagagctctg taggacaatg gattggatat gcaaggccga ctttgaaatc       180
     aaaatcatag ttggtggcaa tcacgatgtc accttggacc aagcattcta cagagagcat       240
     ggagcaaggt tccacggcca gcacctcgaa gattcatacc actgcctaaa tctcattatg       300
     gagtcgcctt cggtcgttct acttcgccat gagcccgccc tgattcgcct gacgcgagcg       360
     gacggaccaa acacagtatt taaaatcttt gggtccccgt actctcagtc cccaggaaat       420
     tgggcattcg gatacgaatc aaatgatgct gctgcgctgt gggctcagat accaatcgac       480
     acggacatcg tcgtcacgca tacgccaccg caatctcact gcgaccagaa accgaatgga       540
     atgttcgttg ggtgcgctgc gcttcgcagc gcattgagcc tcatcaggcc gcacttagct       600
     gtttgtggcc atgtgcatga aggacggggg tacgaacgag ttcgctggcg aggcaatctt       660
     atcaacacag agatagaaac agaaacaggg ccagaatctg attcagttga ccatgtcact       720
     cggggcgttc tgccacccat gggcagcaag aaacagagcc tggtcgattt gactggcaaa       780
     cgggataaac gactagacaa cgagggattt tcacatccta ggccaaggca gcatgatctg       840
     acagagactc aaccaatctc atcagcctca ccagggtcag agtcatctgc tggggttcct       900
     gaaaaggcaa gtcaacgaaa ctcgccgagc actcatccgt ccctgggggc gggtagccct       960
     ggccccaata gccgtggttt tgattatgcc ttgcaaacac taagaaagga gacctgcatt      1020
     gtcaacgccg ctatcatgtc cactagctgg ccgcaccagg ggggcaaacg gttcaattcg      1080
     ccgattgtgg tcgatcttga acttcccgtg tggcagaacc acgcggtcgc gaacgggtga      1140
//

If you have problems or comments...

PBIL Back to PBIL home page