(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE187

PENCW_10.PE187       Location/Qualifiers
FT   CDS_pept        join(434279..434299,434391..434526,434732..435044,
FT                   435116..435254)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225289" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949811"
FT                   /orf_name="Pc13g01870"
FT                   /product="Pc13g01870 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="CAP91256.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="InterPro:IPR005755"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="UniParc:UPI0001830846"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A7"
FT                   /transl_table=1
FT                   /translation="MSSFESVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNIS
FT                   GEFFRAKLKYHAYLRKMTRFNPTRGGPFHFRAPSRILYKAIRGMIPHKTARGAAAMERL
FT                   KVFEGVPPPYDKKKRVVVPQALRVLRLRPGRKYCTVGRLSHEVGWKYQDVVSRLEERRK
FT                   VKSKAYYERKKAARRVLAKAEQGANVDSKTKTQLAQYGY"
     atgtcctcct tcgaatcagt ggtcgtcatc gacggcaaag gacacctcct cggtcgtctg        60
     gccagcactg tcgccaagca gctgctcaac ggtcagaaga tcgtcgttgt gagatgtgag       120
     gccctcaaca tctccggcga gttcttccgc gcgaagctca agtaccacgc ctaccttcgc       180
     aagatgactc gtttcaaccc tacccgtggt ggtcccttcc acttccgcgc tccttcccgc       240
     atcctctaca aggccatccg cggtatgatt ccccacaaga ccgcccgtgg tgccgccgcc       300
     atggagcgcc ttaaggtctt cgagggtgtc ccccctccct acgacaagaa gaagcgtgtc       360
     gttgttcccc aggctctccg tgtcctgcgt ctccgccccg gccgcaagta ctgcaccgtt       420
     ggccgtctca gccacgaggt tggctggaag taccaggatg ttgtttctcg tctcgaggag       480
     cgcagaaagg tcaagagcaa ggcttactac gagcgcaaga aggccgctcg ccgtgtcctt       540
     gccaaggccg agcagggagc gaacgtggac agcaagacca agacccagct tgctcagtat       600
     ggctactag                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page