(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE188

PENCW_10.PE188       Location/Qualifiers
FT   CDS_pept        complement(435946..437340)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076573" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949812"
FT                   /orf_name="Pc13g01880"
FT                   /product="Pc13g01880 protein"
FT                   /function="catalytic activity"
FT                   /function="molybdenum ion binding"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="CAP91257.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0030151"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="UniParc:UPI0001830847"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A8"
FT                   /transl_table=1
FT                   /translation="MLIHLLQSLRISQNGPLVIRGAIVLILPLCILLAVVIQSGNIHTT
FT                   RRRLRHLQKLGLTTSNMADQYNPKFCLPPGTAIDGAPRIKAIYLHPIKSCGPVEVDRAL
FT                   LTKSGFMYDRCFAFATKSVTGDDTAASKWKFISQRKNPVMSRVKTELWLPHKYSNLRDP
FT                   LVQSGGCVVMTFEDPDLPSWTSRVETFFHTRNLSAPSQLSFIVPLDVTAAQAKLKTFGI
FT                   HSRDAKGLDIGGIPSIAAALPKLKKFLGIPADQMLTLFKCTPDTLTRTDKNLAPLEHIG
FT                   SPALHGYTDQQPVNINSLSSVHAVSALLPTENQPLNALRFRANIWIINAPAYEEETWKR
FT                   YRILPKSNGTQPRASVAPALSVVCRTSRCTMPNVNPETGSFDADTPPPGRKRGKAQPST
FT                   TLVQYRTVETGNKAALGYLGMHCVPEDGSLKSAEEQGAGLYIEVGDEIEVLERGAHLYG
FT                   STGDDY"
     atgctcatcc atctgttgca atcgcttcga atttcccaga atggtcctct tgttattcgt        60
     ggtgctatag ttctcatact cccgctatgt atcctcttgg ctgtcgttat acagtctggg       120
     aatatccata caacgcgcag gaggttaagg cacctacaaa agctcggctt aactaccagc       180
     aacatggcag accagtataa tcctaaattc tgcctgccac cggggactgc aattgatgga       240
     gcaccacgca tcaaagcaat atatcttcac cctatcaagt cttgcgggcc tgttgaggta       300
     gatcgggcct tgctcaccaa gtctggtttt atgtatgata gatgcttcgc atttgcgacg       360
     aaatctgtta ccggcgacga taccgcggcc tcgaaatgga aattcatcag ccagcgcaag       420
     aatccagtca tgtctcgggt caaaacagag ttatggcttc cacacaagta cagcaattta       480
     cgtgacccgc tcgtgcagtc aggtggatgt gtggtcatga catttgaaga cccagaccta       540
     ccgagttgga ccagtcgggt tgaaacattt ttccatacaa ggaatctttc cgcaccatca       600
     cagctatcct ttattgtccc tcttgatgtt accgccgctc aggcaaagtt gaaaacattc       660
     ggcatccaca gtcgtgatgc aaagggcctc gacattggcg ggataccatc cattgcagca       720
     gctttgccca agctaaagaa gttcttggga ataccggcag accaaatgct cacgcttttc       780
     aaatgtactc cggatacctt gacccgtacg gataagaacc ttgcgccact tgagcacatt       840
     ggttcgccgg ccctgcatgg ctacacggat caacagcctg tcaacatcaa cagtttatcc       900
     tcggtccatg ctgtgtccgc gctccttccc actgaaaacc agcctctgaa tgcacttcgt       960
     ttccgtgcga acatatggat tataaatgct ccagcatatg aagaagagac atggaaacgc      1020
     taccgcatcc tgccaaagag taacggtacg cagccacgag ctagtgttgc gcctgcactt      1080
     tctgttgttt gtcgcacatc tcgatgcaca atgcctaacg tcaacccgga gactggaagc      1140
     tttgacgcgg atacccctcc tcctggtaga aaaagaggca aagcacagcc aagcacaacc      1200
     ttggtgcagt accgcacggt cgagacggga aacaaagcgg cactcggcta tctaggcatg      1260
     cattgtgttc ctgaggatgg gagcttgaag agcgccgaag agcagggagc agggttatat      1320
     atagaagttg gcgacgaaat cgaggtactt gaacgagggg cacatctcta tgggtcgacg      1380
     ggcgacgact attag                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page