(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE189

PENCW_10.PE189       Location/Qualifiers
FT   CDS_pept        join(438241..438378,438440..438635,438688..439134,
FT                   439203..439832,439888..440195)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824870"
FT                   /orf_name="Pc13g01890"
FT                   /product="Pc13g01890 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91258.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="UniParc:UPI0001830904"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A9"
FT                   /transl_table=1
FT                   /translation="MSGSKSRLSGLLGHFTGSTPPVEHRVNTHTLSPTFFLPRAAAVEP
FT                   NAEAIYHVTANNKILRRSYGETADRARGMAYYLKKHGLSRVGILCPNTPAFLESIFGIA
FT                   AAGAVNIAVNYRLKQEDIAYIFDHGDAEVIIVDEEYVPLLEHYRSQHPRIPIIVDTDTD
FT                   ATEGELTGPFDEAVLEGLRHDIDTGSRGWEGLESQAADEESTIALAYTSGTTARPKGVE
FT                   FSHRGCYLATLGNVIETGLNYHRGRARYLWTLPMFHAMGWTFPWAVTAVRGTHYCLRKI
FT                   DYPEIWRLLKEEHITHFNAAPTVNTLLCNAKEAERLPEPVRVTVAASPPTPLLFEQMTD
FT                   LNLHPVHVYGMTETYGPITKGYHLPEWDELPLKDKYQRMARQGHGFITSLPARVIKTEV
FT                   PAGTITDVRKDGQEIGEIVFVGNICARGYYKDPEATRKLFAGGVLHSGDLAVWHPDGAI
FT                   QILDRAKDIIISGGENISSVALESMLVMHPDILEAGVVAVPDSHWGERPKAFVTVKEGK
FT                   SLQGSDLIDWARNTSGISKFMIPREVEVVTELPKTSTGKIRKNILRDWVKGPREA"
     atgtctggtt caaagtctcg gttgtctggg ctccttggcc atttcacagg ctcaacaccg        60
     ccggttgaac accgtgttaa tactcatacg ctatccccaa ctttctttct tccgcgtgct       120
     gctgccgttg agcccaatgc tgaggcgatc tatcatgtaa ccgccaacaa caaaatcctt       180
     cgtaggagct atggcgagac tgcagaccga gcgaggggta tggcttacta cctcaaaaaa       240
     catgggctca gcagagtggg gatactatgc ccgaataccc cagccttcct tgagtcaatt       300
     ttcggaatcg ccgcagctgg cgctgttaat atcgctgtca attatcgtct gaaacaagaa       360
     gacattgctt atatatttga ccatggtgat gcggaggtga tcatcgtcga cgaggaatat       420
     gttccacttc tggagcacta tcgatcccaa cacccccgca ttcctattat agtagacacc       480
     gacactgatg cgacggaggg tgagctaacg ggcccctttg acgaggctgt tctggaaggc       540
     ctcagacacg acatcgatac aggttctcga ggctgggaag gactcgaaag ccaagctgcc       600
     gatgaagaat ccacaattgc attggcatat actagcggga ctacagcccg tcctaagggt       660
     gttgagttca gtcatcgggg ctgctatctg gcaacattgg gaaacgtcat tgaaactggt       720
     ctgaactacc accgcggacg tgcccgttat ctatggacgc tacccatgtt ccacgctatg       780
     ggctggacat ttccatgggc agtgacagcc gttcgcggaa ctcattattg cctacgcaag       840
     atagactacc ccgaaatctg gaggctgctg aaagaggagc atatcaccca cttcaatgct       900
     gcaccgactg tgaacacctt gctctgtaac gcgaaagaag cagagaggct gcccgagcct       960
     gttcgcgtca cggtggcagc aagcccgccc acaccacttc tcttcgaaca aatgaccgac      1020
     ctaaacttgc accctgtaca tgtttatgga atgacggaga catacggccc aatcaccaag      1080
     ggctaccatt tgccagaatg ggacgagctc cctcttaagg acaaatacca gaggatggct      1140
     cgccaaggcc acggctttat tacaagtctc ccagctcggg tcattaagac cgaagtgcct      1200
     gcagggacta tcacagatgt tcgcaaggat ggccaggaga ttggcgagat tgtttttgtt      1260
     ggaaatatct gtgcccgggg atactacaag gaccccgagg cgactcggaa attatttgca      1320
     ggaggtgtgt tgcactctgg ggacttggct gtctggcatc ccgacggtgc aattcagatt      1380
     cttgatcgtg caaaggatat catcatcagt ggcggcgaaa acatctcctc cgttgcactg      1440
     gagtctatgc tagttatgca tcctgatatt ttggaggctg gtgtcgttgc tgttcctgac      1500
     tcccactggg gcgaacgacc taaagccttt gttacagtga aggaaggcaa gagcctacaa      1560
     ggctcagact tgatagactg ggctcgaaat actagcggaa tcagcaagtt catgattcca      1620
     cgagaagtgg aagtggttac tgaactacct aagaccagca ctggcaaaat ccggaagaac      1680
     atcctacgtg actgggtgaa gggtccgaga gaagcttag                             1719
//

If you have problems or comments...

PBIL Back to PBIL home page