(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE19

PENCW_10.PE19        Location/Qualifiers
FT   CDS_pept        join(complement(43648..44000),complement(43361..43586),
FT                   complement(43242..43301),complement(42899..43189),
FT                   complement(42617..42845),complement(42151..42560))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076559" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128678"
FT                   /orf_name="Pc13g00190"
FT                   /product="Pc13g00190 protein"
FT                   /protein_id="CAP91088.1"
FT                   /db_xref="UniParc:UPI0001830D05"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G8"
FT                   /transl_table=1
FT                   /translation="MASKRSHVFRVTGLSRELLDEDLKTTLQETIADKFADDERSHIKA
FT                   EITIVPSCYESDTQRVALVQFRGGVPQFLRELRVDQLGDWQIEMGDDDINFDCHFFGFT
FT                   QLYTPDKNEPVIADIIAIAGLDGHAYGSWQGRGNLGRMWLRDFLSKDLPQCRTMIYGYN
FT                   SKLSSPGVNTILDYGRELMEDIKKVRTTKQLQQRPLIFIAHSFGGIILAHCLVRAIQTL
FT                   EEDHPAITSLHRATYGIILFAIPHKGLVMDDIQQMLGGDGHHPRETLLRQISSQSDVLI
FT                   HQLADFKNLIRDRKVVSFYETEQTKRLVLDSESGRWKRTGDFMTTVDADSALLQLPDHV
FT                   EDKVPLHADHSMIVKFDMRNAVGYRTALDKLRQFSKKAPSVVAARFNASNAPTTLLHES
FT                   SVRKRNIMDDDSETPKAKRARLHDSASSSNSEESDTAHYEDDNISDDISQVKVYNINEP
FT                   SEESHNGFSESLIARDATSEIGSSFRYGSSSWEGSFSENGLADGSDILEPDELSSSGES
FT                   ISSGC"
     atggctagta aaaggtcgca cgtcttccgg gtgaccggcc tttcgaggga actactcgat        60
     gaggatctca agaccacatt gcaagagaca atcgccgaca aattcgcgga cgacgaaaga       120
     tcgcatatca aagccgagat cacgatcgtg ccttcatgct atgaaagtga cacacagagg       180
     gtggcgctgg tgcagtttcg cggtggggta cctcagttcc tccgtgagct gagggttgac       240
     cagctcggag actggcagat cgagatggga gatgatgaca tcaactttga ctgccacttc       300
     tttggtttta cccagctcta cacgccagac aagaatgagc ctgtgattgc cgatatcatt       360
     gccattgccg gactggatgg acatgcgtat ggatcatggc aaggaagagg aaatctcggt       420
     cggatgtggc tccgggactt cctgtcgaag gatctaccgc agtgccgcac catgatctac       480
     gggtacaact ccaagctgtc gagccccgga gtcaatacga tcctggacta cgggcgggag       540
     ctgatggagg atatcaagaa agtccggacc acgaagcagc tccagcagag acctctaatt       600
     ttcattgcac acagttttgg gggtatcatc ctggctcatt gcttggtgag ggccatccaa       660
     acactggaag aagaccaccc agcgatcacg tcgctgcatc gagccacata cggcataatc       720
     ctcttcgcta tcccacataa agggctagtg atggacgata tccagcaaat gttgggcggc       780
     gatggacacc atccgcgaga gacactccta cgccagattt ccagccaatc ggatgtcttg       840
     attcatcaac tggccgactt taagaacctg atccgggacc gtaaggtggt cagcttctat       900
     gagacagagc agacgaagcg gttggtatta gactcggaaa gcggacgttg gaaacgcact       960
     ggagatttca tgacgacggt tgacgcagac tcggctcttc ttcagcttcc cgaccacgta      1020
     gaagacaagg tgccgctgca tgcagatcac tcaatgatcg tcaaattcga catgcgcaac      1080
     gcggtcggat atcgaacggc gctcgataag ctacggcagt tctcaaaaaa ggcgccatcg      1140
     gtggtggcgg ctcggtttaa cgcctcaaac gccccaacca cgctcctgca tgaatcatca      1200
     gtgaggaaac ggaacattat ggacgatgat tcagaaaccc ctaaggcgaa aagggctcgt      1260
     cttcatgact ctgcaagttc ttcaaactct gaagaaagtg acacggccca ctacgaagac      1320
     gacaacattt ccgatgatat cagccaagtg aaagtctata atatcaacga accttcagaa      1380
     gagagccata atggtttctc agaaagtctt atagctaggg atgcaacaag tgaaattggc      1440
     tcatcttttc gttatggatc ctcttcgtgg gaaggttcat tctctgaaaa tggactcgct      1500
     gatggttctg acattctgga accagacgag ttgtcttcgt cgggggaaag cattagctca      1560
     ggatgttag                                                              1569
//

If you have problems or comments...

PBIL Back to PBIL home page