(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE190

PENCW_10.PE190       Location/Qualifiers
FT   CDS_pept        join(440999..441730,441788..442471,442526..442873)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210294" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949813"
FT                   /orf_name="Pc13g01900"
FT                   /product="Pc13g01900 protein"
FT                   /protein_id="CAP91259.1"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI0001830905"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B0"
FT                   /transl_table=1
FT                   /translation="MHRLREAGRCPSAAPSETSGSTSPERAADDDTDFFMAQANDSQSS
FT                   IGVANFRDSRLSSEPSEPLPPIGRLPPEILIAIFSKLAAPLDMLNSMLVCRGWAANSVG
FT                   ILWHRPTCNTWANVRSVTTSLGKPDSLFNYADLIKRLNLSALSDDVSDGTILSFNQCKR
FT                   IERLTLTSCKNLTDKGVSDLVEGNRHLQALDVSDLRHLTDHTLATVSRDCPRLQGLNIT
FT                   GCSKVTDDALLIVSQKCRQIKRLKLNGVSNVSDRAIQSFAENCPSILEIDLHDCKLVTS
FT                   ASVTPLLTTLRHLRELRLAHCTELDDTAFLSLPPQVTFDSLRILDLTACENVRDDSVER
FT                   IVRAAPRLRNLVLAKCRFITDRSVMAICRLGKNLHYVHLGHCSNITDSAVISLVKSCNR
FT                   IRYIDLACCNLLTDRSVQQLATLPKLRRIGLVKCQAITDQSILALARPKIGHHPSVSSL
FT                   ERVHLSYCVQLRMKGIHALLNSCPRLTHLSLTGVQEFLRENLTVFCREAPPEFTQQQRD
FT                   VFCVFSGDGVNRLRDHLNRHEPQFQEEAEATMYDDDEELDEDEGQMTGLMNATVINDGD
FT                   DDYIDVGPLNT"
     atgcatcggc tacgagaagc cggtcggtgc ccaagtgcag ccccttcgga aacctctgga        60
     tcgacgtcac ccgaacgtgc cgccgatgat gataccgatt tcttcatggc ccaggccaac       120
     gactcgcaat cctccatcgg tgtcgccaat ttccgcgatt cccgcctgtc aagtgaaccg       180
     tccgagccac tgccgccgat cggccgcctc ccaccggaga tcctgattgc gatcttctcg       240
     aaattggctg cgcccttaga catgctcaat tccatgctgg tgtgtcgtgg atgggctgcg       300
     aactcggtag ggatactgtg gcatcggccg acttgcaata cctgggccaa tgtgagaagc       360
     gtgactacat cgttgggaaa gccggacagt ctgttcaact acgcagacct tatcaagaga       420
     ctgaatttat ccgccctgtc agatgatgtc agcgatggaa ctatcctctc tttcaaccag       480
     tgcaagcgga tcgagcggct gacattgaca agctgcaaga acttgacgga taagggcgtg       540
     tcggacttgg tggaggggaa ccggcatctg caggcgctgg atgtttcaga cttgcgacac       600
     cttacagacc acacccttgc cacggtgtcc agggactgtc cccgtctgca aggcctgaac       660
     atcacgggat gttcaaaagt caccgacgac gctttgctta ttgtatcgca aaagtgccgt       720
     caaatcaaaa ggttgaaact caacggagtt tccaatgtat cagaccgggc cattcagtcc       780
     tttgccgaga actgcccgtc tatactggaa atcgacttgc atgattgcaa actcgtcact       840
     agcgcatcag tgactccgct gctcaccacc ctacggcatc tccgagaact gcggcttgcg       900
     cactgtactg aacttgacga cactgcattc ctgtctctac ctcctcaagt gacttttgac       960
     agcctccgca tcctcgatct caccgcatgc gagaacgtca gagatgactc agtggagcga      1020
     atcgtgcgtg cagctcctcg tttacggaat ctggtactgg ccaaatgccg ctttatcaca      1080
     gatcgatctg tgatggccat ttgcaggcta ggaaagaacc ttcactatgt gcacctgggt      1140
     cattgctcga acatcacaga ctcggccgtg atcagcctgg tcaagtcctg caaccgcatt      1200
     cgatacatcg acttggcctg ctgtaacctc ctaacggacc gtagtgtaca gcagttggca      1260
     accttaccga agctccgaag aatcgggcta gtcaaatgtc aggctattac cgatcagagt      1320
     atattagcgt tggcacggcc caagataggc caccaccctt ccgtcagcag tcttgagcgt      1380
     gttcacctga gctattgtgt tcagttgagg atgaagggta ttcatgcttt gctgaacagc      1440
     tgcccgcgcc tgactcattt gagtttgacc ggcgtccaag agttcctgcg agaaaacctc      1500
     actgtattct gccgagaagc ccccccggag tttacgcaac aacaacggga tgtcttctgt      1560
     gtgttcagcg gtgatggtgt caatcgactg cgggatcact tgaaccgaca tgaaccgcaa      1620
     tttcaagaag aagccgaagc cacgatgtac gatgacgacg aagaactgga cgaagatgaa      1680
     ggccagatga ctgggctgat gaacgcaact gtcatcaacg acggagacga tgattatatc      1740
     gacgttgggc ctttgaatac ttga                                             1764
//

If you have problems or comments...

PBIL Back to PBIL home page