(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE191

PENCW_10.PE191       Location/Qualifiers
FT   CDS_pept        443096..443572
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129225"
FT                   /orf_name="Pc13g01910"
FT                   /product="Pc13g01910 protein"
FT                   /protein_id="CAP91260.1"
FT                   /db_xref="UniParc:UPI0001830906"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B1"
FT                   /transl_table=1
FT                   /translation="MCNRIEFKQFSFLSFIIPQFNDCSCVSVADLRSRPAYVVVYTGRL
FT                   FSDSMWDSLGMNPFSPGLPTLNIPEITDPSTFDIGVTTDTVNPRSTLEISRARDLVFTR
FT                   LSSLQQTLPHRRMDGTLQSVIAIWEEYDSRKADSSSIVHWLDVMREKGLVITLW"
     atgtgtaacc gcatagaatt taagcaattc tcatttcttt catttattat tccccagttc        60
     aacgactgca gttgtgttag tgtagcagac ttgcgcagca gacctgcata tgtagtagta       120
     tataccgggc ggctattctc agacagcatg tgggattccc tcgggatgaa tccattttcg       180
     cctggtctac cgactttgaa tatacccgaa ataactgatc cctccacatt cgatatcgga       240
     gttactacgg atacggtcaa tccgcgatca actctggaga tatccagggc gagagacctt       300
     gtcttcacgc gactcagtag cctccaacag acgctgcctc atcgacgaat ggacggaacg       360
     ctacaatctg tgatagccat atgggaggag tatgatagcc ggaaggcaga tagttccagc       420
     attgtccatt ggttggatgt gatgcgcgaa aaaggcctag taataacgtt gtggtag          477
//

If you have problems or comments...

PBIL Back to PBIL home page