(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE192

PENCW_10.PE192       Location/Qualifiers
FT   CDS_pept        join(complement(445074..445433),complement(443747..445030))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949814"
FT                   /orf_name="Pc13g01920"
FT                   /product="Pc13g01920 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91261.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001830907"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B2"
FT                   /transl_table=1
FT                   /translation="MWPLNSKKDDNDTKIANPEPETKDDLESAHIEKIDASIDNIATSI
FT                   DNLPVSWFVWLAALTASMAGLLFGYDTGIISGVLVVLGDSLDGRPATSSEKEMITSLCS
FT                   GGAFIGAIFAGNTADRFGRKMAIYLGCVLFIAGAVLQAAAYTIVQMAIGRLVIGFGVGC
FT                   GAMVLPLYVAEIAPAKARGKLIGLNNMSITGGQVISYAIGAAFASVPHGWRYMVGLGGV
FT                   PAVVLGVLMPFCPESPRHLAYNGRRDEARVVLRKIYAKATEDQIDAVLLSICTACDQAR
FT                   EINESGSRFSKIKKLHTVPSNLRALVSACGLMVISQLSGFNALMYYSATLFSLVGFDNP
FT                   TAVGLVVAGTNFIMTFVNMMVIDGMGRRKLLLSTVWGMSVGMVAIAVAFRWIPINMETM
FT                   EVTTTGISPAAIAVLVFIIWFVVFYGVSVGNTAWMSTDFFPLEVRAMGTMWLTCSNWGA
FT                   NVIISSTFLSMMKAWTTSGAFGFFAAICGLGYIWIYFFYPEVSGLVLEEVKEVFEHGFG
FT                   VDYARQLRKERKDIIEERMKTQEKPIAVGH"
     atgtggccac tcaattccaa gaaagatgac aatgacacca agatagcgaa ccccgaacct        60
     gagacgaaag atgatttgga aagcgcccat atcgagaaga tcgatgccag tatcgataac       120
     attgccacca gcattgacaa cctacctgtc agttggttcg tctggctcgc agcattaacg       180
     gcctccatgg cgggtctgct gttcgggtac gatactggta ttatctccgg tgtcctggtg       240
     gttctgggag actctctgga cggcaggccc gctacaagca gcgagaaaga gatgatcacc       300
     tcattatgtt cgggaggcgc cttcatcggt gccatcttcg ccggtaacac cgcagacaga       360
     ttcggtcgca aaatggccat ttatctcggc tgcgtcctct tcatcgccgg cgccgtcctc       420
     caggccgccg cctatacgat cgttcaaatg gcaattggcc gacttgtcat tggattcggt       480
     gttggctgtg gtgctatggt cttgccatta tatgttgccg agattgcccc agccaaggct       540
     cgtggaaagc tcattggatt gaacaacatg tccatcaccg gagggcaggt catctcctat       600
     gctattgggg cggcgtttgc gagcgttccc catggatggc gatacatggt cgggcttggg       660
     ggtgtgcctg ctgttgttct cggcgtgctc atgcccttct gccccgagtc acctcgtcat       720
     ctggcttaca atggacgtcg cgacgaggct cgtgtcgtgc ttcgcaagat ctacgccaag       780
     gccaccgaag accaaatcga cgcggtactt ctgtctatct gtacggcgtg cgaccaggcc       840
     cgcgagatca acgagagcgg gtctcgattc tcgaagatca aaaagctaca cactgtcccg       900
     agtaacctgc gcgcgctggt cagcgcctgc ggtctgatgg ttatctccca gctgtctggt       960
     ttcaacgctc tgatgtacta ctctgcaaca ctattctccc tggttggttt tgacaatccc      1020
     actgccgtcg gccttgtggt ggcgggcacc aacttcatca tgacatttgt caacatgatg      1080
     gtcatcgacg ggatgggccg caggaagctc ctcctttcga ctgtgtgggg aatgtctgtg      1140
     gggatggttg ctatcgcagt cgctttccgc tggattccca tcaacatgga aacaatggaa      1200
     gtgacaacca ccggaatttc cccagcagca attgcagtgc tggtcttcat tatctggttt      1260
     gtagtattct acggcgtgtc cgttggcaac accgcatgga tgagcaccga cttcttccct      1320
     ctcgaagtgc gtgcaatggg aaccatgtgg ctgacctgct ccaactgggg agcgaacgtt      1380
     atcatttcca gtacattcct ttccatgatg aaggcgtgga ccacctctgg tgcatttgga      1440
     ttctttgctg ctatttgtgg tctggggtac atctggattt acttcttcta ccccgaggtc      1500
     tcgggccttg ttctagaaga ggtgaaggag gtattcgaac atggctttgg agtcgactat      1560
     gccaggcaac ttcgaaagga gcgcaaagac atcatcgaag agaggatgaa gacccaagaa      1620
     aagccaattg cggttgggca ctag                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page