(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE193

PENCW_10.PE193       Location/Qualifiers
FT   CDS_pept        join(complement(448110..448506),complement(446823..448036))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000181424" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949815"
FT                   /orf_name="Pc13g01930"
FT                   /product="Pc13g01930 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91262.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI0001830908"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B3"
FT                   /transl_table=1
FT                   /translation="MGFCNWATVIANLLVPLGILTFSSGFFPYKPLIPGLATFDETGEN
FT                   VTVPAVFDKVIFMVVDALRRCLHIATLYIRMTRVSYLHRGDLIRSGAALPFTAYASAPT
FT                   VTMPRLKAITTGSVPSFLDVILNIAESDTTSTLAYQDTWLAQLKAIGGRLVMYGDDTWL
FT                   KLFPGMFDRADGTTSFFVSDFTEVDHNVTRHVPNELARDDWSALIMHYLGLDHIGHKAG
FT                   PKSPFMLPKQHEMDSVVTDIYTAMQQQHHLQSTLFVLCGDHGMNEAGNHGGSSAGETSP
FT                   ALLLMSPKFEALGRRESPVEPSGDMQYYQTVEQADIAPTLAGLLGIPIPLNSLGVFIPD
FT                   FLDMWDNGSHKLRILRQNAEQLLNTLTTTFPGFTFDSDISTSCASEALSAIEEARCAWA
FT                   RVQRLIYDKDEAGDSYSTVGPALLHFLRIAQEVMSRTASNYDVSRLILGLLITGAAGLL
FT                   VLPATYKECTRHGSSGLFLMLMIVTCGMMMFASSYVEEEQQFWYWICSGWIVYLHIKSQ
FT                   SSAKPVSHKRFGSLLYCIFRPHDTIHETLHIFLMTQSRATNVPLFLIFRIQAGILSSMN
FT                   LTGIEVTITTLVFQYMTFFAFGGSNAISSVDLASGYNGVGSYSVVLVGVLTFASNWAGP
FT                   IWWASQSHRLRPKNPAEQNPSALLTFHVAMSLVSVMAACTALRTHLFIWTVFSPKYLYS
FT                   MAWATANHVAVNLLGEAIFSRSQSRYHYS"
     atggtccaca ttatcaagac ccttgcggta ggtcttttgg cttgcgtcgc acacgccttc        60
     aactatgacc agctctaccg aggtcaatac catttctcgc ctcaggacaa ttggatgaac       120
     gaccctagtg gtcttttata ccacaatgag atctaccatc tcttcttcca gtacaaccct       180
     agcggcattc agtgggggaa tctgtcctgg ggccatgcaa ccagcaagga tctcacgcac       240
     tgggaggagc agcctgtggc cctcctcgcc cggggacata gcggtaacgt caccgagatg       300
     tatttcaccg gaagtgctat cgttgatatg aacaatacaa gtggctttag gaaggatagg       360
     aagactccta tagtcgccat gtacacttcc tttatactcg cacagactct gccaagtgga       420
     aagaccattc aggaaaacca gcaggcccag tctattgcct acagtcttga cgatggtatg       480
     acctagacca cgtacgataa ctccaacccg gttatccata acccgcccgc cccgtatcaa       540
     gatcagtata aggaattccg tgatcccttc gtgttctagc ataaggaatc tgaacagtgg       600
     gttatcatcg ctgctctagc agtaatacat aagttcgtga tttatacttc cgacaacctc       660
     aaagactaga agctggcgag tgaatttggc ccttacaacg cgcaaggcgg tgtctgggag       720
     tgccccggcc ttttccagct ccccctcgat agaggaaagt ccacgaaata gatcctcacg       780
     gccggcctta accctagcgg tcccccgggc acggttggct ctagaaccca gtatttcgtg       840
     ggtgattttg acggaaccac cttttctcca gacgcggata gtgtgtacca cggagatgcg       900
     actactaact agatggacta gggcccagat ttttataccg cggctggcta taatagcgtc       960
     cctatagatg cccttgtcca gatagggtag ataaacaact agcagtatag tgcgaatatt      1020
     cctaccggct cctggcgtgg cgccacggct attcctcggc acttggctct caggacaatt      1080
     ggggataagg tcactctcgt tcagcagccc caagaagcct ggtcttctat cgtaaataag      1140
     agggcggcct attcgcacaa gtacaattct atgctggaag gatccgtcca tttggggacc      1200
     actagtgaga cgatcaagat cgatttgagc ttctctgctg cttcgacggc ttcgaaattt      1260
     gctatcgctg ttcggggttc cgccgacttc actaagcaga cccttgtcgg ttacgacttc      1320
     gtcaacaagc aggtcttcat tgaccgcacc aaatctggag acgtgtcgtt tgacaatacc      1380
     ttcgcgagcg tctatcgagg acccctcgct gcggatgtga atggcaaggt gaacctgagc      1440
     atctttgtcg atcggtccag cgtggaagtt ttcggcggtc agggtgagac cactttgaca      1500
     gctcagattt tccccagcag ggatgcgatt aacacccagc tggtgtcaac tgggggaact      1560
     actaagagtg tcaaaattga tatcttcaat gtcgcctcga cttggaactg a               1611
//

If you have problems or comments...

PBIL Back to PBIL home page