(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE194

PENCW_10.PE194       Location/Qualifiers
FT   CDS_pept        449919..451004
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000252609" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949816"
FT                   /orf_name="Pc13g01940"
FT                   /product="Pc13g01940 protein"
FT                   /function="electron carrier activity"
FT                   /function="molybdenum ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91263.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0030151"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI0001830909"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B4"
FT                   /transl_table=1
FT                   /translation="MSTNESRNESSLAESSRVGRAQNECVTIYRPSQHREAPPPHKQQE
FT                   YITHDTLLFEEMHMGIAVVDIAKWRLVVDGMVENPFSISLPELCALPKLSVVAFHECYG
FT                   SPLRPSDRNIWRVGNVTWTGVPLKFLLNIAQPLGSARYMWSEGLDHGAFAGKKITCYQK
FT                   DVPLEKAMSDEVLVAYEVNSEPLRRERGGPVRLVVPGWFGTNSTKWLWRLSFQAQRAPG
FT                   IFASHYYNRPNPQGGIQPVWEVEPNSMIIDPSPNAKVVGPRVMIRGWAWSWDGIEAVQI
FT                   RQSGKSEWQQAETKPRQDFSWQAFRHFIVLPKGRCSVVAQAISRSGKMQPLENQRNCAH
FT                   NVDFEVIVESEGRIHQITDSL"
     atgtctacga atgagagcag aaacgagtca tcgctcgcag aatcatcacg cgttggaaga        60
     gcacaaaacg agtgcgttac aatctatcga ccaagccaac accgagaagc gcctcctcct       120
     cacaaacaac aagagtatat cactcatgat acactcttgt tcgaggagat gcatatggga       180
     atcgccgttg tcgacatcgc taaatggaga ttagtggttg acggaatggt ggaaaaccca       240
     ttctcgattt cactccctga gttatgtgca ttgcccaagt tgtccgttgt tgcgtttcac       300
     gaatgctacg gaagcccact acgcccatca gataggaaca tatggcgcgt tggaaatgtc       360
     acctggaccg gagttccact caaattcctt ctaaatatcg ctcagccttt gggctccgcg       420
     agatatatgt ggtcggaagg tcttgatcat ggtgcattcg ctgggaagaa aataacttgt       480
     tatcagaagg acgttccatt agaaaaggca atgagcgatg aagttcttgt ggcctatgag       540
     gtgaactccg aaccgcttag gagggaacga ggtggaccag tgaggctcgt agtgcccggc       600
     tggttcggga ccaacagcac caagtggctc tggcggctgt ccttccaagc ccagcgcgca       660
     cctggaatat tcgccagcca ttactacaac agacctaatc cacagggagg aatccaacct       720
     gtatgggaag tggagcctaa ctcaatgatc atcgaccctt caccaaatgc taaagtagtt       780
     ggtccaagag ttatgattcg tggctgggcg tggagttggg atggtatcga agctgttcag       840
     atacgccaat ccggcaaatc agagtggcaa caggcggaga cgaagccacg ccaagacttc       900
     agctggcaag catttcgcca tttcattgtg ttaccgaaag gtcgttgctc agttgttgct       960
     caggctatct caagaagtgg caaaatgcaa cccttggaaa accaacgaaa ttgcgcgcat      1020
     aacgtcgact ttgaggttat tgtcgaaagt gaaggccgaa tacatcagat aacagatagc      1080
     ttataa                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page