(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE195

PENCW_10.PE195       Location/Qualifiers
FT   CDS_pept        complement(451974..452741)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000218797" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949817"
FT                   /orf_name="Pc13g01950"
FT                   /product="Pc13g01950 protein"
FT                   /function="FMN binding"
FT                   /protein_id="CAP91264.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI000183090A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B5"
FT                   /transl_table=1
FT                   /translation="MFLPPVHAETEIAVLFQFIRENPLGMLITGIKSSQEFLQCTHAPF
FT                   VLDLPEETTGSPLQGRLRAHIAKQNPQVKAMIEELVTKPNILELEDNVLVVFNGKYNHY
FT                   VTPKYYVETKPDTGKVVPTWNYSAVQVYGKLSLYYDSKTPEAGAFLAKQMDDLSQHAEK
FT                   SVMGHMGGEKPQPWKVSDAPEKYIELMQRNIVGIEIRIEKVQGKFKMSQEMKPGDREGV
FT                   VAGFTRMGGENAEGMANLVEERGALHDSRAQSG"
     atgttcctcc cgcctgtcca tgctgagacg gaaattgccg tcctgttcca attcatccgc        60
     gagaaccccc tagggatgct catcacggga ataaaatcct cccaagaatt cttacagtgc       120
     acccatgctc ctttcgtcct ggacctcccg gaggaaacca ctggctcccc actacaaggc       180
     cgtctccgcg cacacatcgc taagcaaaac ccgcaagtga aagccatgat cgaggaactc       240
     gtgaccaagc ccaatatact cgagcttgaa gataacgtac ttgtggtgtt caatggtaaa       300
     tataaccact acgtcacacc caaatactac gtcgaaacca agccagacac gggcaaagtc       360
     gtccccacat ggaactactc ggccgtccag gtctatggta agctctctct ctattatgac       420
     tcgaagactc ccgaggcagg cgcttttctg gcaaaacaaa tggacgattt gtcacagcat       480
     gctgagaagt cggtcatggg gcatatgggc ggcgagaagc cgcagccatg gaaagtgtct       540
     gatgcgccgg agaaatatat tgagttgatg cagcggaaca ttgttggcat tgagattcgc       600
     attgagaaag ttcagggcaa attcaagatg agtcaggaga tgaagcctgg tgaccgggag       660
     ggtgtggtgg cagggtttac gcggatgggc ggcgagaatg cggaggggat ggcgaacttg       720
     gttgaggaaa ggggagccct gcatgactca agggcgcaaa gtggatag                    768
//

If you have problems or comments...

PBIL Back to PBIL home page