(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE196

PENCW_10.PE196       Location/Qualifiers
FT   CDS_pept        join(453284..453655,453721..453787,453950..454134)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235081" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949818"
FT                   /orf_name="Pc13g01960"
FT                   /product="Pc13g01960 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91265.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="UniParc:UPI000183090B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B6"
FT                   /transl_table=1
FT                   /translation="MSRPTPLRIAVLINTPSDDYDFWTDVRQAWQESFAKVAPNAEVDF
FT                   YDPVFERAFPDASKYDLIALSGGKADASSSDPWVLGVLDFVRTVVRDHPKTKILGVCWG
FT                   HQAVARALGGEVGAVPTGPIAAIQDIALTDAGKKFLTFATSAVLSFQAHPEISNRLAKK
FT                   MLLADDKEYNGNSTAEQLKAEVQKLDQPTDGVKLLKRVIQWLDE"
     atgagcagac ctaccccttt gaggattgcc gtcctcatca atacaccatc agacgactat        60
     gacttctgga cagacgtccg tcaggcctgg caagagtctt tcgccaaggt tgcccccaac       120
     gccgaggtcg atttctacga cccagtcttc gagagagcct tcccggatgc gtcaaaatat       180
     gacctaattg cgctaagtgg aggtaaagca gacgcatctt catctgatcc atgggtgctc       240
     ggagtacttg atttcgtgcg caccgttgtg cgtgatcacc ccaagacgaa gattcttggt       300
     gtctgttggg gacatcaagc tgtggcgagg gcactcggtg gggaggttgg agctgttccg       360
     acagggccaa tcgctgctat ccaagatatc gctctcacgg acgcgggcaa aaagttcctg       420
     acattcgcca ccagcgccgt tctttccttc caagctcatc ccgaaatttc gaataggctg       480
     gccaaaaaaa tgcttcttgc agacgataag gagtacaatg ggaactctac tgctgagcag       540
     ttgaaggcgg aggtgcagaa actcgaccaa ccaactgatg gtgtgaaatt gctgaagcgg       600
     gtcatccagt ggctagacga gtaa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page