(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE197

PENCW_10.PE197       Location/Qualifiers
FT   CDS_pept        join(complement(456868..456957),complement(455215..456816))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235017" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949819"
FT                   /orf_name="Pc13g01970"
FT                   /product="Pc13g01970 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91266.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000183090C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B7"
FT                   /transl_table=1
FT                   /translation="MYEPAPPRPKKTDIVRSRNGCQSCRKRRTKCDEKKPVCGTCVRLG
FT                   IVCESVKLDLKFRVVTAPPPKKTGAKAEPAEPDSTRLGLQLFGQHSRSPQIPNINLAQS
FT                   LQHTDRDVFYSTYWEDHCLPALHPIFRCASELLGFPALKDAILALSSCNISRIYAERKY
FT                   STSFPTTGTLSPNLIHQTRSQLYYSSAIKKFISLTQDDHRNNAAEVLTILVLFGYIEAS
FT                   MGNFDGYYCHVQGLSAFLVELRETTGYSLYRALLISWLQSQFLIWWARTYFSSLDVQRN
FT                   MPSIDFPRGLEGTSDSFHDLRVVVLSILCESHRLNVKETLKHWRDKTDFEPALASVLQS
FT                   DRDDTEDRFARLQDESKRLDEWLSYLPPSEQPLVGDASETSPIFFQAHDAALNFAYYVV
FT                   ARIMQCISFLRNLPCRDAQHLGSECLEIEPWARLLLRIVQGTDMQTSIIRNNYTIGFSG
FT                   LLLAASLRCQDLSLSMQIEKWLQTLEEKQPTEEGAFPVYQALAVVKAINRQRTMGRDVF
FT                   GVSQTMDDGGGMPKFTHYNSQMITNILVHGKCRSTGDLFTECIDLQ"
     atgtacgaac cagctccccc tagacccaag aaaacagata ttgtccgctc gcgtaatggc        60
     tgccagagct gtcgcaaacg acgcaccaaa tgtgatgaga aaaagccagt gtgcgggaca       120
     tgtgttaggc tggggatagt gtgcgagagc gtcaagctag acttaaaatt ccgggtcgtg       180
     accgcacccc ctccaaagaa aacaggtgca aaggcggagc cagccgaacc cgactcaact       240
     cgcctggggc tgcagctctt cggccaacac agtcgaagtc ctcaaatccc aaacatcaac       300
     ctcgcccaat cattgcaaca tactgatcga gatgtctttt actcaactta ctgggaggat       360
     cactgcttgc cagcactaca tccaatattc cgttgcgctt ctgagttgct tgggtttccg       420
     gcgttgaaag atgccatcct cgctttatct tcgtgcaata tcagccgcat ttatgccgaa       480
     agaaaatact caacatcctt tccgactacg ggaacactta gtccaaacct tatacaccaa       540
     acaaggagtc agttgtatta ttcttctgcg atcaaaaaat ttatttcgct cactcaagac       600
     gaccaccgaa ataatgccgc agaggtcctt acaattctag tcctctttgg ctacattgaa       660
     gcgtctatgg gtaattttga cggatactat tgtcatgtcc aaggcctgtc ggcatttctc       720
     gtcgagctcc gcgagaccac tggatattca ctgtacagag ccctcctcat ttcatggcta       780
     cagtcgcaat ttctgatctg gtgggcgcgt acatacttca gttctctcga tgtacagcga       840
     aatatgccct cgattgattt cccaaggggc ctcgaaggaa cctctgactc cttccacgat       900
     ctacgggtcg tggttctaag cattctatgt gaatcccatc gactgaatgt gaaggaaact       960
     ctcaaacatt ggagagacaa aacagatttc gaaccagccc tcgcaagcgt tctgcagtcc      1020
     gacagagatg acacggaaga ccgcttcgcg cgattacagg atgagtccaa aaggctcgac      1080
     gagtggctat catatctgcc accatcggaa caaccgcttg tgggtgatgc ttcagaaaca      1140
     tcacccatct ttttccaagc acacgatgca gccctcaatt ttgcttacta cgttgtggcc      1200
     cggattatgc aatgcatatc tttcctgcgc aatcttcctt gtcgcgacgc ccagcatctc      1260
     ggcagtgagt gcttggagat agaaccatgg gcccgcctcc tacttcgaat tgtccaagga      1320
     accgacatgc aaacgtccat tatccggaat aactatacaa tagggttctc gggtttgttg      1380
     ttagctgcgt ctctccgctg tcaggacctc tctcttagca tgcagatcga aaagtggctg      1440
     cagaccttag aggagaagca gccgactgag gagggggctt tccctgtata tcaggcgctt      1500
     gctgtggtca aggcgataaa tcggcagagg acaatgggcc gcgacgtgtt cggggtctcg      1560
     cagaccatgg atgatggcgg tggaatgccc aagttcactc attataacag ccagatgatc      1620
     actaacattt tggttcatgg gaagtgtagg tctactggcg acctcttcac agagtgtata      1680
     gatctacagt ag                                                          1692
//

If you have problems or comments...

PBIL Back to PBIL home page