(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE199

PENCW_10.PE199       Location/Qualifiers
FT   CDS_pept        461140..462651
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129227"
FT                   /orf_name="Pc13g01990"
FT                   /product="Pc13g01990 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91268.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183090E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B9"
FT                   /transl_table=1
FT                   /translation="MSFELEGTKLSLGVAFTTSCGFLLFGYDQGVFGGLIENGSFQSTF
FT                   RQPSQMVIGQIAATYDLGCFFGAIFCMVYGDRIGRRLSIALGCIVLTIGAVIQTVSFSV
FT                   AQIIVGRFIAGLGNGLNTTAIPVWQSEMSKPQHRGRLAVFHLVLNQLGNVTAQWLNFGL
FT                   GYIGHQQVSWRFPIAFQIFYALVTLVLLPWLPDSSRWLIQKGRLEQAKAVTARLHAKGI
FT                   HDPDLLALHEASVQSVQHELEVSKVSWRTLLQRDSLQTRRRVLLGMGTQFMQQWGGINA
FT                   INYYLPVVFASLQVSRQMSLILSACNAINVMVFTAVALTTIEKVGRKRLMLWGAVGQGT
FT                   CFALLTSGLGVGGSQWSAVAIAFVFAYYTVFGMSWIAVPWMYPAEINTQAWRNRGAGLA
FT                   TATNWICNYAVVLVTPIGIENIDWRYYIIYVVLNFSFVPIVSFWYVETAGLSLEEIDKI
FT                   FEGKTYGIPLDVSEGGATTENEEGKARQDEVNSEWIEAVDSSKRD"
     atgagctttg aacttgaggg tacgaaactc tcgttgggcg ttgccttcac cacttcttgc        60
     ggcttcctgc tctttggtta cgaccaagga gtctttggcg gcctcattga aaacggaagc       120
     ttccaatcaa ccttccggca acctagccaa atggtaatcg gacagattgc tgcaacctat       180
     gacctcggct gtttcttcgg tgccatattc tgcatggtct atggagatcg aattggtcgt       240
     cggctttcca tcgccctagg atgtatcgtg ctcacgattg gggccgtaat acaaacagtg       300
     tcgttcagcg tagcgcagat catcgtaggt cgattcattg ctgggctggg aaacggcctc       360
     aacacaactg caattccagt ctggcagtca gagatgtcca agcctcaaca ccgtggtcgc       420
     ctggccgttt tccacctcgt cctcaaccaa ctaggcaatg tgacggccca gtggctcaat       480
     tttggtcttg gatatatcgg ccatcagcaa gtctcctgga gattccctat tgcctttcag       540
     attttctacg cccttgttac cctcgtcctg cttccatggt tacctgattc gtcacgatgg       600
     ctcattcaaa agggtcgact cgagcaagcc aaggctgtca cagcccgact ccatgccaaa       660
     ggtatccatg atcccgattt attggcttta catgaagcat ccgttcaaag cgttcaacat       720
     gagcttgaag tctccaaagt cagctggcgc actctcttgc aaagggacag cctacaaacc       780
     agaaggaggg ttctcctagg aatgggcact cagttcatgc agcagtgggg tggcatcaat       840
     gcaatcaact actatttgcc cgttgtgttt gcctctctgc aagtctcccg ccaaatgtca       900
     ctgatcctgt ccgcttgcaa tgcgatcaat gttatggttt tcactgcggt cgccctgaca       960
     accattgaga aggttgggcg gaaaagactc atgctatggg gcgcggtggg ccaaggcact      1020
     tgctttgccc tgttgacgtc cggcctgggc gttggaggaa gtcaatggtc agctgttgca      1080
     attgccttcg tgttcgctta ctatactgtg ttcggcatgt cctggattgc cgtaccgtgg      1140
     atgtatccgg cagaaataaa cacccaagcc tggcgcaacc gtggcgctgg acttgcgact      1200
     gcgaccaact ggatctgcaa ctacgccgtt gtcttggtga ctcccattgg cattgagaat      1260
     attgattggc ggtactatat aatatatgtt gttttgaact tttcttttgt tcctattgtt      1320
     tctttctggt atgtggaaac tgccggttta tctttggaag agattgataa aatatttgag      1380
     ggaaaaacat acggtattcc cctggatgtg tcagaaggtg gcgctaccac tgagaatgaa      1440
     gaaggcaagg ctagacagga tgaggtcaac agtgaatgga ttgaagcggt tgattcaagc      1500
     aagcgagact ag                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page