(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE20

PENCW_10.PE20        Location/Qualifiers
FT   CDS_pept        join(complement(45190..46061),complement(44937..45033))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671650"
FT                   /orf_name="Pc13g00200"
FT                   /product="Pc13g00200 protein"
FT                   /protein_id="CAP91089.1"
FT                   /db_xref="UniParc:UPI0001830D06"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H4"
FT                   /transl_table=1
FT                   /translation="MSAQTETSSMPCPFHKDDQLNGDLDTSLDYLPGHPRIRLGDEKGL
FT                   FEFIRREVWSEDLESISGRLWWMSKQDSSNISPLHRQRVKGRQIIVTEDPRLHLVWIDD
FT                   RIFLKPLPQYITSFVFWDTFMSDPSKLGAAVKLRKAALGYLRTYFYLIQYESDLRIAQD
FT                   PALCLVPKEVTWHRFCQFTARLNDITENEISGRYHYGEIRLTRLNYYAPVLLGKSHYQR
FT                   ENYQYRAYFARIQGPLISAFAFFSIALNCMQVSLAASTSDERYSSALLFAACYWLSTLI
FT                   GFVTGVLMLMLVLKSFLTGDLTEVFSNIDSSVTDFANSTKC"
     atgtcagctc aaacagaaac ctcttcaatg ccatgcccct ttcacaaaga tgatcagctc        60
     aacggtgatt tggatacatc gcttgattac ctgccaggcc atccccggat cagacttggc       120
     gatgaaaaag ggttgtttga attcattcgc cgcgaagtct ggtcagagga cctcgagtcg       180
     atatcgggca gactttggtg gatgtcaaag caggatagca gcaatatctc tccgttgcat       240
     cgacaacgag tgaagggccg acagatcatc gtcaccgagg atcctcggct acatctcgtc       300
     tggatcgacg accgaatctt ccttaaaccc cttccccaat acatcacgtc cttcgtattc       360
     tgggatacgt tcatgagtga tccgtctaaa cttggtgcgg cggtgaagct gagaaaggcc       420
     gcactcgggt atctgcgaac gtatttctac ctgattcagt atgaatcaga tctacgaatt       480
     gcacaagacc cggctctctg cctggttcct aaagaggtga cgtggcatcg attttgccag       540
     ttcaccgccc gtttgaatga catcacggaa aacgaaattt cgggacgata tcattacgga       600
     gagatccgat tgacccggct gaactattac gcgcccgtgc tcctgggcaa aagccattac       660
     caacgtgaga attatcagta tcgagcgtat tttgctcgaa ttcaaggtcc cttgatatct       720
     gcatttgcgt ttttctcgat cgccctgaat tgtatgcagg tcagcctcgc agcctctaca       780
     tccgatgaga gatattcgag tgctttacta tttgcagctt gctactggct cagcactttg       840
     atcggatttg taactggtgt ccttatgctg atgttggtac ttaaatcatt tttgactggt       900
     gacttaactg aggtgttttc taatatagat tcctcggtta cagacttcgc gaattccaca       960
     aaatgttga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page