(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE200

PENCW_10.PE200       Location/Qualifiers
FT   CDS_pept        join(462938..463012,463078..463160,463216..463559,
FT                   463644..464103,464154..464362,464416..464548,
FT                   464605..464829,464890..465045,465097..465772)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000215643" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129228"
FT                   /orf_name="Pc13g02000"
FT                   /product="Pc13g02000 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91269.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000183090F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C0"
FT                   /transl_table=1
FT                   /translation="MPQTKTVKPARKHVTTACIPCRDGKCDGSKPSCKNCESKNKDCTY
FT                   RQRNDKRKIPVRVAVSLLASRVAVLSQHIQNAGFGVPAMDKNDRDTLRGILQSLGIACE
FT                   NVLSDENTSHSAGASFPGSQRPVDTTRFVAHDQTNITSPQPPAPGCDNYHPGGDLPPLH
FT                   ERSAGPSQLSESYRMHVVTPTQFPPNVDVIPSENPETDSEDEVTDQFACRLGRVQLTHD
FT                   GQLRYFGSTSNLNLLDVSDDIRNFTSSLFQKDAQDTLEDLGLNIEVEEAFEKHLLQLYF
FT                   AWQDPCLHVVDSEAFWKAKNQNRYEGLTSAYYSQALCDAMCAMGAAYEPKYHPDLVTFP
FT                   RSLSQFFGDRAKALLELEIENPSLATIQALVICSNYEASGTRDTRGWLYSGMAMRLAFD
FT                   QGLHLDVTPYVEKGIITAEECKIRRTVFWSSSLNDQFWGYYLGRSVRSPVAGVSVRKPC
FT                   WNDRSPMSQQAPRWRSYGCSQVNIQGIANPSDMIFQQWIALYDLMSPVTDVLYGCLEIS
FT                   RTALQELTADTVARLLAWKNNLPNDLNVDATKESYYYLPHVLTLHLQYYQFMIHCHRPY
FT                   ISKNHIQPRPLQGPGPGHARRMCLESAISIVKVLNMYERRYSFRKANVQMVSYVFSAAL
FT                   ILMFVTVPGQSSTQHSDLVRYLSTCFWALDEMGTCFENAKRTSRFLSTLQQQWHKRKRG
FT                   MAQKGAKRGPENENSPGKHPKRSRNTAGTQNWLGDNLCSSAELGVPVAVDSPISHETHD
FT                   LSFFGDNGPDLVEFMDPELCNILLSDGIPRAMN"
     atgcctcaaa ccaagaccgt caagcctgca cgcaagcacg ttacgactgc atgcattcca        60
     tgtcgagacg gtaagtgcga tggatcaaag ccctcatgca agaactgcga gtccaaaaac       120
     aaggattgta catacagaca gcgcaatgac aaaaggaaga tccccgtccg cgttgccgtt       180
     tcgctcttgg cttcaagagt tgcagtcctc tctcaacata tccagaatgc gggcttcgga       240
     gttccggcta tggacaagaa tgaccgagat accctaagag gcattttgca gagcttagga       300
     attgcctgcg agaatgtgct aagtgacgag aatacatccc acagcgcagg agccagcttt       360
     cccgggagcc agagacctgt tgatacgacc cgcttcgtgg cccatgacca gacaaacatc       420
     actagtcctc aaccaccggc tccaggatgc gataattacc atcctggcgg tgatttgcct       480
     ccacttcatg agcgatctgc tgggccgagt cagctttccg aatcatatcg catgcatgtt       540
     gtgacaccga ctcagtttcc ccccaatgtt gatgtgatcc ccagtgaaaa ccccgagacc       600
     gacagcgagg acgaagtcac tgaccaattc gcatgtcgct tggggcgtgt gcagttgacg       660
     cacgacggtc aattacggta ttttgggtcg acatctaacc taaacttgct tgacgtttca       720
     gatgacatta gaaattttac atcttctctt tttcagaaag atgcacaaga tacactggag       780
     gatttgggtc tcaacataga agtggaggag gcttttgaga agcatctact ccagctttac       840
     ttcgcctggc aagacccttg tctgcacgtt gttgacagtg aagcgttttg gaaggccaaa       900
     aatcagaatc gatatgaagg cttaacttca gcttattatt cgcaggcttt atgcgatgca       960
     atgtgtgcaa tgggtgcagc ttatgagccc aagtatcatc cagatcttgt tacattccct      1020
     cggtccttgt cacagttttt cggggatagg gccaaagccc tcctggaact ggagattgaa      1080
     aacccttcac tggcaacaat tcaagcgctg gtaatatgca gtaattatga agcttcaggt      1140
     actagagaca ctcgcggctg gctgtatagt gggatggcca tgcgacttgc atttgaccaa      1200
     ggtctccatt tggatgtcac cccttacgtg gaaaagggta tcatcacggc agaggaatgt      1260
     aagattcgac gaacagtttt ctggagctcg agtctcaacg accaattttg gggctactat      1320
     ttgggacggt ctgtccgaag cccggtagct ggcgtctccg ttcgaaaacc atgctggaat      1380
     gacaggtctc ctatgtctca acaggcacca cgttggagat cttatggatg ctcgcaagtc      1440
     aatatccaag gtatagctaa cccatcggac atgatattcc agcagtggat tgctttatat      1500
     gacttgatgt cccctgtaac tgatgtactt tatggctgct tggaaatatc gaggacagcg      1560
     cttcaagagc tcaccgctga cactgtcgca cggctgcttg cttggaaaaa taacctgccc      1620
     aatgacctta acgttgatgc gaccaaagag tcctactact atttgcccca cgttctcact      1680
     ctgcatttgc aatattatca gtttatgatt cactgccatc gcccctacat atcgaaaaat      1740
     catatacagc ctagaccatt acaagggcct ggacctggac atgcacgcag aatgtgtctc      1800
     gaatcggcaa tctcgatagt caaagtcctc aacatgtatg agcgacgata cagttttcga      1860
     aaggcaaatg ttcagatggt gtcgtacgtg ttctcagcag cacttatact catgttcgtc      1920
     actgttccag gccaaagcag cactcagcac tcagacctag taaggtacct gagtacatgc      1980
     ttctgggcat tggatgaaat gggcacttgc tttgaaaatg cgaagcgaac aagcagattt      2040
     ttgagtacgc ttcagcagca atggcataaa cgcaagcggg gaatggccca aaaaggcgca      2100
     aaaaggggtc cagagaacga gaatagtccc ggcaagcatc caaaaaggtc gcgaaataca      2160
     gctgggacac agaactggct gggtgacaat ctatgtagct ctgcagaact gggcgtgcct      2220
     gttgccgtgg actcgccaat atctcacgag actcacgacc tttcattctt tggagacaat      2280
     gggcctgatt tggttgaatt tatggatccg gagctgtgca atattttact gagtgatgga      2340
     ataccgcggg caatgaatta a                                                2361
//

If you have problems or comments...

PBIL Back to PBIL home page