(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE201

PENCW_10.PE201       Location/Qualifiers
FT   CDS_pept        join(complement(468008..468200),complement(467635..467952),
FT                   complement(466749..467578),complement(466612..466684),
FT                   complement(465931..466562))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000225953" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949820"
FT                   /orf_name="Pc13g02010"
FT                   /product="Pc13g02010 protein"
FT                   /function="transketolase activity"
FT                   /protein_id="CAP91270.1"
FT                   /db_xref="GO:0004802"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="UniParc:UPI0001830910"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C1"
FT                   /transl_table=1
FT                   /translation="MPDDEHAVLTLRNLIFDICNQNGGGHGGSAVGMAAIGVALWKHIM
FT                   RYNPSNPDWFDRDRFVLSNGHCAMFLYALNYLTGFNAWTMNELKGYGGGKENGFTTIAH
FT                   GHPEIECPGIEVTTGPLGQGIANSVGLAIASKNLAARFNRPGYEVVSSRVYCMTGDGCL
FT                   MEGVALEAISLAGHLQLDNLVLVYDNNGVTCDGPLSWINTEDINQKMRASGWHVLDVMD
FT                   GCDNVQAICSSLRRAQSLKGKPTFINIRTVIGVGTTTAGTAKAHHGSFDVESVAKSKLA
FT                   IGQDPYQSHKPTARGLDYFRERKQHGEALEKSWQHLLMQYTLDFPDLASDFASRLRGAK
FT                   PDLGSLLQDLDSSQFSQMPTRESNGLILQKLWETCPSFCGGGADLVNSNKFFYSDTDVF
FT                   HPSVSYQGRYIRYGIREHAMASISNGLAAYHPGTFLPVTATFLMFYIYAAPGVRMGALS
FT                   HLPTIHIATHDSFAEGQNGPTHQPVELDSLYRAMPNLTYIRPSDAEEVIGAWMWAVESA
FT                   SSPTMISVGRDPVDQPAITSRFNVSKGAYVLEEHPDAQLTLVSCGTSLHYAIRAANELS
FT                   EQLSIRCRIVSAPSFDLFDQQPAEYRESVFPLDGNPIISVEEYVATTWARYVTASVGMT
FT                   SYGYSASNPSNYERFGLDTRGIVLRVKRYLAFLNGRSARQMGWRSI"
     atgcccgacg atgagcacgc ggttctaacg ctgagaaatt tgattttcga catatgcaac        60
     cagaatggtg gaggccatgg tggatctgct gttggtatgg ctgctatagg tgtggcttta       120
     tggaaacaca tcatgcggta taacccctca aatccagact ggttcgacag agaccgattt       180
     gtgctttcca acggacattg tgccatgttc ttgtatgccc tcaattactt gacaggattc       240
     aatgcttgga caatgaatga gctaaagggc tatggtggcg ggaaggaaaa tggattcacc       300
     accatcgcac acgggcatcc ggaaattgaa tgccccggta ttgaagttac cactggccca       360
     ttgggacagg ggattgccaa ctcggttggc ttggctattg cttccaagaa cctagcagcc       420
     cggtttaaca gacccggtta tgaagtagtc agctctcgag tttactgcat gacgggtgat       480
     ggctgcttga tggaaggtgt tgctctcgaa gcaatttcgt tggcaggcca tctccagctg       540
     gacaatctgg tgttagtcta cgacaacaat ggtgtcactt gtgatggccc tctttcgtgg       600
     attaataccg aggatatcaa ccagaaaatg cgggcttctg ggtggcatgt tcttgatgta       660
     atggacggat gtgataatgt tcaagccatt tgctcctctc tgaggcgtgc ccaatcctta       720
     aaagggaagc ccacttttat caacatccgt accgtcatcg gtgttggtac taccacagct       780
     ggaacagcga aagcacacca tggaagcttt gacgttgaaa gtgttgcgaa gtccaagttg       840
     gcgattggac aagatcccta tcaaagtcac aaacccactg cgcgtggctt agactacttc       900
     cgtgaacgaa aacagcacgg agaagccttg gaaaagagtt ggcaacattt gctgatgcaa       960
     tacaccctcg acttccccga tttggcaagc gattttgcct ctcgactgcg gggtgcgaag      1020
     ccagatttag gatcacttct ccaggatttg gacagcagcc aattcagcca aatgccaacc      1080
     agggagtcaa atggactcat tcttcaaaag ctttgggaga catgtccttc attttgtggc      1140
     ggtggtgcag accttgtcaa ctccaacaag tttttctact cggataccga tgtctttcac      1200
     ccctcagtga gctaccaggg ccgatatatc agatatggga tcagggagca tgctatggcc      1260
     tctatctcaa atggtcttgc agcataccac ccgggaacct ttttaccagt caccgcaaca      1320
     tttttgatgt tctacatcta tgcagcaccc ggagtgcgca tgggagctct tagtcatctt      1380
     ccaactattc atattgcaac tcatgactcg ttcgctgagg ggcagaatgg tcctactcat      1440
     cagccagtgg agcttgactc cttatatagg gccatgccaa atctcacata catccggcca      1500
     tctgatgccg aagaggtaat cggcgcttgg atgtgggccg ttgaatccgc aagcagtcca      1560
     acgatgattt ctgttggtcg tgatccagtc gaccagccag caattacaag cagatttaac      1620
     gtatccaagg gagcatacgt acttgaggag cacccagatg cccagctgac attagttagc      1680
     tgtggtacga gtttgcacta cgccattcgt gctgcaaacg agctgagtga gcaactttcg      1740
     attcgttgcc ggattgtcag tgctcctagc tttgatctgt ttgatcagca gcccgcagaa      1800
     tacagagagt ctgttttccc cctcgatggc aaccccatca tcagtgtgga ggaatatgtg      1860
     gccaccacgt gggcacgtta tgttacagca agtgtgggca tgacatccta cggttactct      1920
     gcgtctaacc caagcaacta cgagcgcttc ggattggaca cgcgcggaat tgttcttcga      1980
     gttaagagat acctcgcgtt cttgaacggc cgcagtgcaa gacagatggg ttggcgatca      2040
     atctaa                                                                 2046
//

If you have problems or comments...

PBIL Back to PBIL home page