(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE202

PENCW_10.PE202       Location/Qualifiers
FT   CDS_pept        join(complement(469641..470083),complement(469174..469585),
FT                   complement(468820..469122))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949821"
FT                   /orf_name="Pc13g02020"
FT                   /product="Pc13g02020 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91271.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018309E1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C2"
FT                   /transl_table=1
FT                   /translation="MTVSPRTSKGQYLHGPQQLRLEERPMPSIGPSDVRIRVRSTTLCG
FT                   SDMHYFKFGRNGSIEVKEPLCGGHEAAGEVVEVGATALETGKFKVGDSVAIESGVACLE
FT                   CDRCKAGRYNICAQMRFRSSGASFPHFQGTLQEFVDHPAEWCHKLSRTLSFDDGALLEP
FT                   LSVCVHSVNRAGMKQGARCLVLGAGAVGLLCAAVAKIEHRSPVVIADVDKGRVAFALEH
FT                   GFADVGFVVDPKKGDTVESRLSVAKDLALQIGNQKWPGGEEVRQVDHVFECTGVESCVQ
FT                   TSIYATTNGGNVVLVGMGTAIQTWPIAELTGREINVVSVWRYVNCYPRAIEIMEGVRAN
FT                   SLKPDVTKLITHQFVGLDSIPSAYDTAGKTRDGESKLVIKTVVNF"
     atgaccgttt ctcccagaac cagcaagggc cagtacctgc acggcccgca gcagttgcgt        60
     cttgaggagc gaccaatgcc ctctatcggc ccgtctgatg tgagaatccg cgttcggtca       120
     acgaccttgt gtggctccga catgcactac ttcaagttcg gcagaaatgg atcaatcgaa       180
     gtcaaagagc ctttgtgtgg tgggcacgaa gcagcgggtg aggtggtgga agttggcgcg       240
     acagctctgg aaactgggaa gttcaaagtc ggcgattccg tggcaataga gagtggtgtc       300
     gcatgcctgg aatgcgacag atgtaaagct ggccgatata atatctgcgc ccaaatgcgc       360
     ttccgaagca gcggcgcatc gtttccccat ttccagggga ctcttcagga gttcgtcgac       420
     catcccgcgg agtggtgtca caagttatca agaacactct catttgatga tggtgctttg       480
     ctggagccgc tgtctgtctg tgttcattca gtcaacaggg caggtatgaa gcaaggggcg       540
     cgatgcttag ttcttggtgc tggggcagtc ggtcttttgt gtgctgcagt tgcaaaaatt       600
     gaacatagga gccctgttgt gattgccgat gttgacaaag gccgggttgc attcgccctg       660
     gaacacggct ttgcagacgt aggattcgtg gttgacccga agaaagggga cactgttgaa       720
     agccgtcttt ccgttgcgaa ggatctggcc cttcagattg gcaaccagaa atggccagga       780
     ggtgaagagg tgcgccaggt tgaccatgtt tttgagtgta cgggggtcga aagttgcgtg       840
     caaacatcga tatatgcgac tacgaatggc ggaaatgttg tgcttgtggg aatgggcact       900
     gccattcaaa catggcctat cgcagagctc acgggtcgtg agatcaatgt ggtatcagtg       960
     tggcgctatg tgaattgcta tcctcgggca atcgagatca tggagggtgt gagagccaac      1020
     tctctcaaac cggacgtgac gaagctcatt acgcatcagt ttgtcgggct cgattctatt      1080
     ccatcagcct atgacactgc cgggaagaca cgagatgggg agtctaagtt ggttattaag      1140
     acagtcgtta atttctga                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page