(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE204

PENCW_10.PE204       Location/Qualifiers
FT   CDS_pept        join(472872..473198,473252..473992)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000227439" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978064"
FT                   /orf_name="Pc13g02040"
FT                   /product="Pc13g02040 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91273.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018309E3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C4"
FT                   /transl_table=1
FT                   /translation="MTKVKANIGVVGLGRMGQRHALNILHQVPRAKLFAVCTPASHEIE
FT                   WAKAKLVPDGVLVFQSFEEMIHTPGLDAVVIASPTELHIAQTLTAMQLEIHVLCEKPIT
FT                   RDIPQLRDLMETAKQHPQTKVMVGFVRRFDENYMDAIQKIKSGAIGEPLIVRSQGAEKL
FT                   DKSGFFIEYARQSGGIFVDTVVHDIDLTLSILGEEVRPKALWATGIIAHHHEMKDFKDV
FT                   DNSVGVVEFWGGRIAHYYHSRTTSHGYDNCTDIIGMNGKISINSVPHSNRVQVSNASGI
FT                   MQDCTPSWIDRYREAFVTEVNQFTDAILDNTELPMRLSAAYTGLKIATAFQESLETGRK
FT                   IEFDENGDRIVSNGK"
     atgacgaaag tgaaggccaa tatcggtgtg gttggcttag gccggatggg ccagcgtcat        60
     gcattgaata ttctccacca agtcccccga gccaagctct tcgcagtttg tacaccagca       120
     tctcatgaga tcgaatgggc gaaggcaaaa cttgtaccag atggggtgct tgtatttcag       180
     agcttcgaag agatgatcca tacgcctggg ctagacgccg tggtcatcgc gtcgccaacc       240
     gagctacaca tagcgcagac attgaccgct atgcaactcg agatacatgt tctttgtgaa       300
     aaaccgatca caagagacat cccacagtta cgtgatttga tggaaacagc aaagcagcat       360
     ccccaaacaa aggttatggt tggattcgtc cggcgttttg acgaaaacta tatggatgcc       420
     atacagaaaa tcaagagtgg cgccataggg gagcctctta ttgtccgttc acagggtgcc       480
     gagaagctgg ataaaagtgg cttcttcatc gaatatgctc gacagagtgg tggaattttt       540
     gtggacaccg tcgttcacga cattgacttg actttatcta tcctaggcga agaagtcaga       600
     cccaaagctc tctgggctac tggaatcatt gcccatcatc atgaaatgaa agatttcaag       660
     gatgtcgata actccgtggg tgtcgttgaa ttctggggtg gccgaatcgc ccactactat       720
     cattcccgca caacctcaca cggctatgac aactgcacgg atatcattgg catgaacgga       780
     aagatctcca ttaactcggt acctcactct aatcgggttc aggtatcgaa cgcgtctgga       840
     atcatgcaag actgcacccc tagttggatc gatcgatacc gagaagcctt tgtcactgag       900
     gtgaatcaat tcaccgacgc tattctggac aatacggagc ttccaatgag gctttccgct       960
     gcctacacag gtctcaagat cgcaactgcc ttccaagaaa gtttggaaac tggtcggaag      1020
     atcgagtttg atgaaaatgg tgaccgaatc gtgtccaatg gcaaatag                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page