(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE205

PENCW_10.PE205       Location/Qualifiers
FT   CDS_pept        join(complement(475405..475471),complement(475207..475351),
FT                   complement(475078..475155),complement(474932..475013),
FT                   complement(474660..474883),complement(474394..474610))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15949822"
FT                   /orf_name="Pc13g02050"
FT                   /product="Pc13g02050 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91274.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI00018309E4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C5"
FT                   /transl_table=1
FT                   /translation="MANLASSLAARFSLGGRVILITGGGRGIGMALSKTCLDAGATVVV
FT                   TDVLPQPDPVFLDWRKSTPDQLHYYCCDLTNKEEVGRTFTSILEKFHHIHGVVTAAGIC
FT                   IDKPFLKHEWEDIQNLQAVNETGTFFAVQNVVKNMKQYGIKGSIVMICSQSAQHVCPGH
FT                   LLTAYAGSKGFVFSMARSLAHELAPDGIRVNTVSPGYIATDMNLSLASLRPELLKIFCE
FT                   APPLRRVGTPQDVELAVLYLLSGGSSYVTGQDLAIDGGMQVSSGNYKL"
     atggccaacc ttgcatcctc tttggcggct cgtttcagtc tcggtggccg agtgatccta        60
     atcactggtg gtggtcgggg tattggcatg gcactttcga aaacttgttt ggatgctggt       120
     gccactgtag tggtcaccga cgttctaccc cagcctgatc ctgtctttct tgactggcgg       180
     aagagtactc cagatcagct tcactactac tgctgtgatc tgaccaataa ggaggaggtc       240
     ggacgcactt ttaccagcat cctagagaaa ttccaccaca tccacggagt agtcacggca       300
     gccggaattt gtatcgacaa gccattcttg aagcatgagt gggaagatat ccaaaatctc       360
     caagctgtga atgagacggg aacattcttc gcagtacaga atgtcgtgaa gaatatgaag       420
     cagtatggta ttaaaggaag tatcgtgatg atttgctcac agtcagcgca acatgtctgc       480
     cctggtcatc tgctgactgc ctatgcggga agcaagggct ttgtgttttc aatggcaaga       540
     agtctggccc acgagctggc tcctgatgga atccgtgtta atactgtctc tccgggatac       600
     attgccacag atatgaatct ctcacttgca tctcttcggc cggagttgct caaaattttc       660
     tgtgaagcac caccccttcg gcgcgtcgga acaccacagg acgtggaact ggccgtgttg       720
     tatttgttga gtggtggttc ttcttatgtc actgggcagg atcttgctat cgatggtggc       780
     atgcaagtct cctctggaaa ctataagctg tag                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page