(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE206

PENCW_10.PE206       Location/Qualifiers
FT   CDS_pept        join(complement(476694..476973),complement(475746..476632))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949823"
FT                   /orf_name="Pc13g02060"
FT                   /product="Pc13g02060 protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91275.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018309E5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C6"
FT                   /transl_table=1
FT                   /translation="MTQTGKHALIFGASGISGWSLLNQTLQYPTPTTFNRVTGLCNRPW
FT                   ISEDAYLPDDNRLNIVSGIDLTQSVEAVKAQLKEKVAKVESVDVVFFCAYIQTGDFQSL
FT                   RKVNTDLLQTAIKAISAVSPTMEAVILQTGGKGYGLEFPKEVTIQPPLHEKMPRIPSPW
FT                   RENVFYYDQYDLLKRLSEDQNWTFTEIRPDGIVGFAPGSNVMNMAYGIAFYLTLYREVN
FT                   GKDAKVPFPGRLHGYHTRHTDTFQDILSKMEIFAALNRGKCQNGSSFNCGDGEAVTWAQ
FT                   VWPGICSYFGLNGVEPDGMQKNMQDFVSENKAIWDRLVLTHDLKKGLIESQNWGHTNFM
FT                   LVDFDFAREYSLEAARSVGFNEQIDTLQGYHVTFDRMVNARFIPVPSS"
     atgacccaaa ctggaaagca tgcccttatc tttggagcct ctggaatctc cggatggtct        60
     ctcttgaacc aaaccctcca atacccaacc ccgacgacct ttaaccgcgt gactggcctg       120
     tgcaatcggc catggatcag cgaggacgct tatctccctg acgataaccg cctcaatatt       180
     gtgtcgggca ttgacctgac acagtccgtg gaagcggtaa aagctcagct taaagagaag       240
     gtcgcgaagg tggagtcagt cgacgtggtt ttcttttgtg cttacattca gactggcgac       300
     ttccagtcgc tgcgcaaggt caacaccgat cttctccaaa ccgccattaa agccatctcc       360
     gctgtttcac ccacaatgga agcggtcatc ctgcagactg gtggtaaggg gtatggattg       420
     gagttcccta aagaggtcac catccagcct cctctccacg agaagatgcc ccgcattcct       480
     tcgccatgga gagagaacgt tttttactac gaccagtatg atctcttaaa aaggctctct       540
     gaagaccaaa actggacctt cactgagatt cgaccggatg gcattgtcgg cttcgcccct       600
     ggctccaacg tcatgaacat ggcatatggt attgccttct acttgactct gtacagagaa       660
     gtcaatggaa aggatgccaa agttccattc cccggtcgtc tgcacggtta ccacactcgc       720
     cacaccgaca ccttccaaga catcctttct aagatggaaa tcttcgctgc tcttaaccgc       780
     ggcaagtgtc aaaacggatc aagctttaat tgtggcgacg gagaggctgt cacctgggct       840
     caggtctggc caggaatttg ctcttatttt ggcctcaatg gtgtcgagcc agatggcatg       900
     cagaagaata tgcaggattt cgtttccgag aataaggcga tctgggaccg cttggtcttg       960
     actcatgacc tgaagaaggg cctcattgag tcgcagaact ggggccatac gaacttcatg      1020
     cttgttgatt ttgactttgc ccgggagtat tcccttgagg cagctcgatc cgttgggttc      1080
     aacgagcaga ttgatactct ccagggttat catgttacat ttgaccggat ggtgaacgcg      1140
     aggttcatac ccgtgccttc ttcttga                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page