(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE207

PENCW_10.PE207       Location/Qualifiers
FT   CDS_pept        join(478622..478821,478879..479223,479283..479481)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000202856" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824871"
FT                   /orf_name="Pc13g02070"
FT                   /product="Pc13g02070 protein"
FT                   /protein_id="CAP91276.1"
FT                   /db_xref="UniParc:UPI00018309E6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C7"
FT                   /transl_table=1
FT                   /translation="MSDFWLTEHIRHLVVQPADARLNPPEGYLFVQDGFIISCGVIYAL
FT                   LYVFVMIRAVKDRVLPGTIKYLSLTLAYELYYAFATTSTRLERICFLAWFELDLTFVAL
FT                   ALWRVYRPDQRKRIAGEMFIYCITALAGLRYLGYLYPDDREQITAYWTGILLQLPVGWV
FT                   YVYGLVKHRSLLGHSLEIWLLRYLGCFTAYGLFIWRYLNVPRNWEYVGSFWSIATIVTT
FT                   LIPETVYPFLYIWVFNQNRNKVKMG"
     atgtctgact tttggttaac ggagcatatc cgccacctgg tggtgcaacc tgccgatgcg        60
     cgtctaaacc cacccgaggg ctaccttttc gttcaggatg gttttattat ctcatgcggg       120
     gtaatatacg cccttttata tgtgtttgtt atgataagag ctgtcaaaga tcgggtcttg       180
     ccaggaacaa tcaagtactt gtctttgaca ttggcgtatg agttatacta cgcctttgcg       240
     actacatcaa cgcggctgga gagaatatgc tttcttgctt ggtttgagct agacctgacg       300
     tttgttgcgc ttgcgctctg gcgtgtctat cgccccgatc aacggaagcg cattgccgga       360
     gagatgttta tatactgtat aacagctcta gcagggttga gatacttggg atatctctac       420
     ccagatgacc gcgagcaaat tacagcatat tggactggta tcctcttgca acttccggtt       480
     gggtgggtgt acgtatatgg gctggtgaaa catcgttctc tactgggcca ctcccttgag       540
     atttggctcc tgcgttattt gggttgcttc acggcttatg gtcttttcat atggcggtat       600
     ctcaacgtcc ctcgaaactg ggagtatgtg ggatcgtttt ggagcatcgc gactattgtg       660
     accactctta tcccggagac agtatatccc ttcctatata tctgggtatt caatcagaac       720
     agaaacaagg taaaaatggg ttag                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page