(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE211

PENCW_10.PE211       Location/Qualifiers
FT   CDS_pept        join(complement(485581..485714),complement(485406..485532),
FT                   complement(485337..485349),complement(484774..485273))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672164"
FT                   /orf_name="Pc13g02110"
FT                   /product="Pc13g02110 protein"
FT                   /protein_id="CAP91280.1"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="UniParc:UPI00018309E9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D0"
FT                   /transl_table=1
FT                   /translation="MPKKKGCAAKIVKKPSWIPVSPDLSRDRVIQNNLPGKELLYALAS
FT                   LRLHSKYSDISLTCGNTIYTVYKCIVCTRSEFFAKACSSGFKESSIDYRVKGCLSGSSH
FT                   DILEETSTVNDSGSPTVFTAKPIPYIAESGADEDSLGRPVEPIEDLIAEIDPLSFHILI
FT                   YSLADRMFIVGLEAISKAKVERELLRRLDANTFQSAIVEIYNSTPASDRGLRDLAVEIT
FT                   LYHLRELRTSKERADFAFPSWRDPCHNLRLICLPQ"
     atgccgaaga agaagggttg tgccgcgaaa atagttaaga agccgtcatg gattccagtg        60
     tcaccagatt tgtcccggga tagggttatt caaaacaacc ttcccggtaa agagcttctt       120
     tatgctctag caagcctacg tcttcactcg aaatatagcg atatatcact tacgtgtggt       180
     aacactattt atacggtgta taagtgtatt gtttgcacgc ggtcggagtt ttttgcgaaa       240
     gcctgtagta gtggatttaa ggaatcttct atcgattatc gtgttaaggg ttgtctttcg       300
     ggatctagcc acgatattct agaggagacg tcgaccgtta atgactccgg cagccctacg       360
     gtctttacgg ctaaaccaat cccctatatc gcagagagtg gagcggatga ggacagccta       420
     gggaggcccg ttgagcctat cgaagattta attgctgaaa ttgatcccct atcatttcac       480
     attttgatat attctctcgc agaccgaatg tttatcgtag gtttagaagc aatatcgaag       540
     gctaaagtcg aacgagaact actacggcgg ctggatgcca acacattcca gagcgctata       600
     gtagagatat acaactctac tccggcaagt gatcgaggtc tacgagactt ggcagtggaa       660
     ataactctgt atcatctcag ggaactgagg actagcaaag aacgagctga ttttgctttt       720
     ccaagttggc gagatccgtg ccacaatttg cgtctgattt gcttgccgca atga             774
//

If you have problems or comments...

PBIL Back to PBIL home page