(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE212

PENCW_10.PE212       Location/Qualifiers
FT   CDS_pept        486089..486868
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000333" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949825"
FT                   /orf_name="Pc13g02120"
FT                   /product="Pc13g02120 protein"
FT                   /protein_id="CAP91281.1"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniParc:UPI00018309EA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I0"
FT                   /transl_table=1
FT                   /translation="MAGDTIPKLAVLIDADNARPSVVNLLLSEIAKYGTAHAKRAHGDW
FT                   TRSSLQGWKDVLLEQSIQPIQQFAYTHGKNATDSAMIIDAMDLLYSNRYDGFCLVSSDS
FT                   DFTRLAARIRESGLIVYGFGEQKTPKPFVAACDKFIYTENLVHLDELVPHTNSVMIPGN
FT                   HVPTLQAQNDSRLRNQLRTTVEAASDDDGWARLSSVGQLLTKKYPDFDSRSYGYHKLSD
FT                   LIAASSWFETTRRSLRNGLSPEIFVRDKRRKSKALAD"
     atggccggtg acaccattcc caaactcgca gttcttattg acgcggacaa tgcgcggccc        60
     tccgttgtca atctcctact ctccgaaatc gcgaaatatg gtacagctca tgcgaaacgg       120
     gcacatgggg actggactag atccagccta cagggctgga aggatgtgct ccttgagcaa       180
     tccatccaac ctattcaaca attcgcgtat acccacggca agaatgcgac cgactcagct       240
     atgattatag atgcgatgga ccttctgtac tctaaccgtt atgacggatt ctgccttgtc       300
     tcaagcgaca gtgattttac ccggttagcc gcacgcatcc gcgagtcagg gctaattgtg       360
     tacgggttcg gggaacagaa gacgcccaag ccgtttgtcg ctgcctgcga caaatttatc       420
     tacaccgaaa acctcgtgca tcttgatgag cttgtgccac atactaacag tgtcatgatt       480
     cctgggaatc atgtaccgac cctccaggct caaaacgata gccgcttaag aaaccagttg       540
     cgaacgactg tagaagcagc ctccgatgat gatggctggg ctaggctctc tagcgtcggc       600
     caactcctca caaaaaaata tcctgacttc gactctcgtt cctacggata ccacaagctc       660
     agcgatctga tcgccgcctc atcttggttt gaaactaccc gccgctccct tcgaaacgga       720
     ttgtccccag agattttcgt acgcgataag cgtcggaagt ctaaggctct tgctgattag       780
//

If you have problems or comments...

PBIL Back to PBIL home page