(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE213

PENCW_10.PE213       Location/Qualifiers
FT   CDS_pept        join(488391..488465,488526..488550,488620..488826,
FT                   488925..489012,489151..489451,489538..489808,
FT                   489916..490672,490726..490975)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949826"
FT                   /orf_name="Pc13g02130"
FT                   /product="Pc13g02130 protein"
FT                   /protein_id="CAP91282.1"
FT                   /db_xref="InterPro:IPR014870"
FT                   /db_xref="UniParc:UPI00018309EB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I1"
FT                   /transl_table=1
FT                   /translation="MWPLSPLLLLSLAAGSFVRLSSYPLAVKTPYLPAWLPGDQAKNVS
FT                   TARPEFWAGQPLTWKVITRVNGEVYSLFGCPDENITSVDQISISYSATHTVVTLKTGNN
FT                   NNIEGEVDVMTAIDESWSAQPGQMVMGCAAPSTILSQFPLFGQVSRNISNYTRDDLVAF
FT                   AYRFGCRNVVQTSSVTFAIGLQQDLNGFFGEVYESLYFEPLWSTTEEVVDHFLEDEACA
FT                   REESKKLDQQLIIFCSWLISSSWGLIHISVPWCSKDTSYHLGFMKAISASGRVSPISGL
FT                   LPSALPAFYVLAPDYIPLLLKPVLNMTLGWPMDYALHDIGKHYPNATGPTENDEYTFPL
FT                   QQTSTLLWMVYAYQKPSGDIEWAKPFLPALHRYADYLVRHGQYPPEERSTIDHNESRAN
FT                   QTLIAISASIGLKAYGALSGMANYTDIGNLYASTIMDLGTDTKQAHFTSHYGRADSSWI
FT                   TSYPLAYDKLLGLDTFDEAVYEMQSTWYKDLIQPDGLQFSSDVQFTVADLEMMAAATCS
FT                   NDVQALIVDSLHQTTTSRIDSVPGPTRWNVTGANSGRQSSTKAQAAVGGYWMLAAVNMS
FT                   GQGVPVELPSELWLTQDIYQVPLKPSQVSLTKVRIPELIAQGHKGQTQKNGTAVRPGAQ
FT                   QPEGSKDIQEVVTASKLIHIDL"
     atgtggcctc tcagtcccct cctactgctt tccttggccg ccggcagttt tgttcggtta        60
     tcatcgtatc ccttggctgt caagacccca tatctaccag catggctgcc tggcgatcag       120
     gccaaaaatg tatctactgc acgaccagag ttctgggccg gtcagcctct tacttggaaa       180
     gtgatcacac gggtcaatgg tgaagtatat tcgttgttcg gatgcccaga cgaaaatatt       240
     acttctgtgg accagatcag catctcctac tcagcaactc acaccgtcgt gactttaaag       300
     acgggaaaca acaacaacat agagggcgag gttgatgtga tgacagcaat cgatgagtcg       360
     tggagtgcgc agccaggtca gatggtgatg ggatgtgctg caccgtctac aatattgtcc       420
     caatttcctt tgtttggtca agtttcccga aacatcagca actacacacg agatgactta       480
     gttgcattcg cttaccggtt cggttgtcgc aatgtagtcc aaacatcctc agtcacgttc       540
     gccatcggct tgcagcaaga tctaaatggc ttctttggag aggtgtatga atcattgtac       600
     tttgaaccgc tttggtccac tacagaggag gtagtcgatc acttcttgga agatgaggcc       660
     tgcgcccgtg aagaatcaaa gaagctcgac caacaactta tcattttctg cagctggcta       720
     atttcgtcca gctggggttt aattcacatt tcggtgccat ggtgtagcaa ggatacatca       780
     tatcacctgg gattcatgaa agctatctct gctagtggtc gagtcagccc aatttctggc       840
     ctccttccaa gcgctctacc ggccttttac gtcctagcac cggattacat ccctctgctt       900
     ttaaagcctg tattgaatat gacgctcggc tggccaatgg actatgcctt acatgatatt       960
     ggaaaacatt accctaacgc aactggccct accgagaacg acgaatatac cttcccatta      1020
     caacagacaa gcactctgct ttggatggtt tacgcttacc agaagccttc tggtgatatt      1080
     gagtgggcaa agccattctt gccagcacta caccgatatg ccgattacct cgtacggcac      1140
     ggtcaatacc cacctgaaga acgttcgacc atagaccaca acgagtcgcg ggccaaccaa      1200
     accttaatag caatatctgc ctccattggt ctgaaggcct atggcgcact tagcggaatg      1260
     gccaattaca cggacattgg aaatttgtat gcgtcaacta tcatggacct tggcacagat      1320
     acaaaacagg ctcattttac ctcgcactac ggtagagccg actcttcctg gatcacgtcc      1380
     tacccacttg catatgacaa gctgctaggg ctagacacat tcgacgaggc agtgtacgag      1440
     atgcagtcga cctggtacaa ggatctgatt cagcccgatg ggctgcagtt ttcaagtgat      1500
     gtccagttta cagtggccga tttagagatg atggcagccg caacctgttc gaatgatgtg      1560
     caagccttga ttgtagatag tctgcatcag acgacgacgt ctcgtattga ttctgtccca      1620
     ggacctactc gttggaacgt gactggagcc aattctggcc gccagagctc aacaaaagct      1680
     caggctgctg tggggggcta ctggatgctg gcggcagtca atatgtctgg acagggagtt      1740
     cctgtcgaac ttcccagcga attgtggctc actcaggata tttaccaagt gcctcttaag      1800
     ccttctcagg tgtctctcac aaaggttagg atccctgagc ttatagctca aggccacaag      1860
     ggccaaacgc aaaaaaatgg aactgcggtg cggcccgggg cgcagcaacc agaaggatcc      1920
     aaggatattc aggaagttgt tacagcctca aaactaatac atatagattt gtag            1974
//

If you have problems or comments...

PBIL Back to PBIL home page