(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE214

PENCW_10.PE214       Location/Qualifiers
FT   CDS_pept        join(complement(492493..493149),complement(492423..492448),
FT                   complement(491427..492373),complement(491195..491359))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949827"
FT                   /orf_name="Pc13g02140"
FT                   /product="Pc13g02140 protein"
FT                   /function="RNA binding"
FT                   /function="RNA-directed DNA polymerase activity "
FT                   /biological_process="RNA-dependent DNA replication "
FT                   /protein_id="CAP91283.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003964"
FT                   /db_xref="GO:0006278"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniParc:UPI00018309EC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I2"
FT                   /transl_table=1
FT                   /translation="EVRKKRNPIGGIEIFTTSLSEIDRILTIKSSIEEDLKLREIKKIL
FT                   PLEYHDLAEVFSKKKLDKLPLYRPGVDHDIILKAEAXPGYYPLYKLSLNKLKAAKXYII
FT                   KNLDKGFIILSASPYISLILIVKKPSGRLRFYINFRKLNIITKKDYYPLPLIDKVLXRT
FT                   SKAKYFTKLNIRXGFYRIRLTLGAEDLTTFRTRYGSFKYKVILFGLTNGPAIFXRFINN
FT                   ILREYIDKYIVTFI"
     atgtccaagg ctcttggact tgctagagtt tcttcatcaa ttaatccaaa aaatatcgtg        60
     aacaatcgtg ccccattggc ccgcgccaat gtccctaacg ccgccgttga caatgccaat       120
     gccgctcccg cgcgcgcgcc ctctgggtcc agcgaacagg ccacagagtc tcctcgcctg       180
     agcagcgcca acatcgcctg gactatgatg tccctctgtc tgtctgtgct cctctctgcc       240
     ctcgatttaa caatcgtgac tcccgcaatt cccgccatag tcggctcgtt ccagtctgcc       300
     gccggttata cttgggtggg gggcgcctat actctagcct acgcagcggt aactccggta       360
     tgggggtccg tctccgacat ctggggccgg aagccgatca tgctgatcgc ggtagccatc       420
     tttttggtcg gaagtcttgt ctgtgcactt gcaccgaaaa tgaacgcttt gattgtaggc       480
     cgtgcaattc agggactggg gggctcgggt atggggataa tggtcaatat tgttgtcagt       540
     gacatgttct cgctgcggga tcgagggcta tatctcgcca tcacctcatt ggtttgggcg       600
     gttgggagtg ccataggacc ggtattgggc ggtgttttta cagagaagct gaggcagctg       660
     gcgatggtgt ttttggatca atctaccggt cggggccgtc tcctttctcg tcttactatt       720
     cttcaagaga gtccaaagcc cccgaactcc gatcgccgcc ggtctaaaag tcatcgactg       780
     gacaggaagc gttctaattg tagggggtgc tctgatggtc ctcctggccc tcgagtttgg       840
     cgacgtcgtc tactcctggt cttccgcaac agtgatctgc ctattaattt tcggcacagc       900
     agtgatggcc ctgtttgtgg tcaatgagtg gaagattgcc aagaacccta ttatccctct       960
     ttggctattt gcctcgccga gcaaggtagc gccgtacgtt gtctttgcgt gcaactcata      1020
     tgtcttcatc gggcaggcat attacctacc cctgtacgcg cagtctgccc tagccgcaac      1080
     agccttgatg tcaggactgt acctgcttcc gctaatcgtc tcatgcgccc tggccgcagc      1140
     cgcagcgggg attttcatgc agcgaactgg gaaatatctg cccgtgatgt atattgcgca      1200
     gggctttttg gtccttggct cgggactgct aatcagtctc aaatttgaat ccaacataac      1260
     taaactagtc atcttccaga ttctggtcgg gatcggcgtg ggcatgaaca tcgaagcccc      1320
     tatcctggcg gctcaagctg ctgcaggtgt tcgtgatacg gctgctgtga ctgcgacaat      1380
     ggggtttgtc cggtcccttt ccaccgctat ctcagttgtc gtcggtggcg tggtctttca      1440
     gaatgagatg aatgcgaaga acggggagtt ggcaagccgg ctcggttcgg attcatctct      1500
     agccaacata ttcaatggcg acaatgctgc ttcgagtgtg gagaagatta gcaccgttgg      1560
     actgaatgta gatcaacaag tcttggttag gaagacgtac tttgaggcgt tgaggatggt      1620
     gtgggtcatg tatgttgcct ttgccggatt agccaccatt cttaatctat ttgtgcgggc      1680
     ccgtaagctc cggagtgaaa atgagggcgc cgtgctgggc gttgatcggt cacggcaaga      1740
     agacagccgt accaatgggg tcacggaaat ggagttgaat gatcaacatg attaa           1795
//

If you have problems or comments...

PBIL Back to PBIL home page