(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE217

PENCW_10.PE217       Location/Qualifiers
FT   CDS_pept        495404..498367
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210305" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949828"
FT                   /orf_name="Pc13g02170"
FT                   /product="Pc13g02170 protein"
FT                   /function="peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP91286.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniParc:UPI00018309ED"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I3"
FT                   /transl_table=1
FT                   /translation="MATRKARNPLAFMPWPVTILTTAMYLALIIPLLVIHHNVPPAPRT
FT                   SPNGLNLTEAWQDLQSLTKGFHPYNSHQNDEVRSWLLERIDAIKQSTPSTEEYRDAKEE
FT                   KPDVFVFDDLVSNLTFIDKSVGVYFEGTNILVYIRGSEDNKQNWWETPGRAPVGKGGVL
FT                   VNAHYDSVSTGYGATDDGVGVVTCLQLVKYFLTPGHAPRRGLVVLFNNGEEDYLNGARV
FT                   YSQHPMARFAHTFLNLEGAGAGGRATLFRSSDTEVTQAYAKSEHPFGSVLSANGFEKGL
FT                   ISSQTDYVVLEGILGLRGLDVAFFEPRARYHTDQDDARHTSIDSLWHMLSTAVATTEEL
FT                   VSDTTDRFDGHIRDDGTVPSGSGTRAVWFDLFGSAFAVFRLHTLFALSVTLLIVAPLTL
FT                   LVTSVILSRADKMYLFRSSVYSEINDDYIPLRGLRGFFRFPFLISIPTGVTVGLAYMVT
FT                   KVNPFIAHSSSYAVWSMMISAWIFLAWFVSRVANSARPSAFHRVYTWTWMFVLTWSLMV
FT                   VCTVYEHEEGLAGGYFIFFYFAGTFLATWISYLELFALPTKSEYVGRLAESRRPSTQGS
FT                   RLAASGDEHQDDAAEEDPTESTSLLHGRHRPTFANYVRVGVDRASQDEEEEEEDPNVYE
FT                   HEQGWSGVLPRWTWLLQLLITAPVILMLIVPLALLTTSALSQTGQDGSPQLLIYLFISC
FT                   LTALLFAPMLPFIHRYTYHLPIFLLFVFIGTMIYNLVAFPFADSNRLKLFFLQEVDLDN
FT                   GISTASLTGMPPFVSDVTYGLPSAAGQNESCDWTFRGKRKLQRCSWSAPLPHVVPDGDS
FT                   LSVSSEDADSLLDATELSPDWISFSISHPQRDSSSVRFEVSGQNTRNCRINMDGNSITN
FT                   FSVIGSSAPDHRFLNPSPDGLNRIQLWSRTWDNKWTVDVDFSKHDSSETDEVDESSITG
FT                   RITCLWSDNNRVGLIPALDEVRQFSPAWVAVTKFSDGLIEGSRAFEIKRSSLGALGS"
     atggctaccc gcaaggccag gaaccctctg gcatttatgc catggccggt aacaatcctc        60
     actaccgcca tgtacctcgc cctgattatc ccattgctgg tgatccacca caacgtccca       120
     cccgcgcccc ggacgagccc caacggcctc aacctcacag aggcatggca agatctccaa       180
     agcctgacaa agggctttca cccctacaac tcccaccaga atgacgaggt ccgctcatgg       240
     ttgctcgaac gcatcgacgc gatcaagcag tccaccccat ccaccgagga ataccgcgac       300
     gcgaaggagg agaagcccga tgtttttgtt ttcgacgacc tggtgtccaa cctgactttt       360
     atcgacaaaa gtgtcggcgt ctactttgaa ggcaccaata tcctcgttta cattcgcggc       420
     tctgaagata ataaacagaa ttggtgggag acacccggcc gagcgcccgt tggcaaggga       480
     ggagtacttg tcaacgcgca ctacgacagt gtttcaaccg ggtacggagc gacagacgat       540
     ggagttggtg ttgtgacgtg tctgcagctg gtgaaatact tcctgacacc gggccatgca       600
     ccgcggcgtg ggttagtggt tctcttcaat aatggcgagg aggactattt gaacggcgca       660
     cgcgtgtaca gccagcatcc gatggcgcgc tttgctcaca cattcctgaa cctggagggt       720
     gcgggtgctg gagggcgtgc tacattattc cgcagctcgg atacggaggt cacccaggcg       780
     tatgcgaaat cagaacaccc attcggctcg gtgttgagtg ccaacggctt cgaaaagggt       840
     cttattagca gccagacgga ttatgttgtt ctggagggta tcttgggcct gcgcggtctg       900
     gatgtcgctt tctttgaacc tagagctcgc taccatactg atcaggatga tgcccgacac       960
     accagtatcg actcgctttg gcatatgctc tctactgctg ttgctacaac ggaggagctt      1020
     gtgtctgaca ccactgatcg gtttgacgga catattcgcg acgatggaac tgtgcctagc      1080
     ggctcaggta cccgggctgt ttggtttgat ctgtttggga gcgcttttgc cgtgtttcgg      1140
     ctacacacac tctttgcgtt atctgtcact ctgctgattg tggcgccgtt gacattgctt      1200
     gtcaccagtg tcatcctttc aagggctgac aagatgtatc tcttccgctc atcggtgtat      1260
     tccgagatca acgacgacta cattccgttg cgtggtttgc gcggtttctt ccggtttccg      1320
     ttcttgatct caattcctac aggagtgact gttggattgg cttacatggt gaccaaagtc      1380
     aaccctttta ttgcccatag cagttcatat gccgtatgga gtatgatgat ctcagcatgg      1440
     atcttcttgg cttggtttgt atctcgcgtc gccaactccg cacgaccatc agcctttcat      1500
     cgagtctata cctggacttg gatgttcgtt cttacctggt ctctgatggt agtttgcacc      1560
     gtctatgagc atgaggaagg gctcgctggc ggctatttca tcttctttta ctttgccggt      1620
     accttcttgg ccacatggat ctcctacttg gaattgttcg ctctgccgac gaagtcagag      1680
     tacgtcggta gattagccga atcacgacgg cctagtaccc agggaagccg gcttgctgca      1740
     tcgggcgatg agcaccagga cgatgctgct gaagaggacc cgactgagtc aacctcactc      1800
     ttgcacggcc gacaccgccc cacatttgcc aactacgtcc gcgttggggt agaccgcgca      1860
     tctcaagacg aagaggaaga agaggaagat ccgaacgtgt atgaacacga gcaggggtgg      1920
     agtggcgtgt tgccgcggtg gacgtggctg ctgcagctgc tcatcacagc tcccgtaatt      1980
     ctcatgctga tcgtgccgct ggctcttctg actactagcg ctctcagcca aaccggtcag      2040
     gatggtagcc ctcagctcct catctatctc ttcatttctt gtcttactgc actcctcttt      2100
     gcgcctatgc tgccatttat ccaccgctac acataccacc tgcctatctt cctactcttt      2160
     gtgttcatcg gaaccatgat ctacaacctt gtggccttcc cgttcgcaga ctctaaccgc      2220
     ctgaagctgt tcttcctgca ggaggtcgat ctcgacaacg ggatctctac tgcttcactg      2280
     actggcatgc ctccgtttgt cagtgatgtt acctacgggc tccccagcgc agctggccaa      2340
     aatgagtcct gtgactggac tttccgaggc aaaagaaaac tccagcgatg ctcctggagt      2400
     gcaccactac cgcatgttgt ccccgatggt gactctctat ctgtttcaag cgaggatgca      2460
     gattctctgc ttgatgctac cgagctgtcg ccggactgga tttccttcag catttcccat      2520
     cctcaacggg acagttcctc cgtccgcttc gaagtatcag gccaaaacac acgtaactgc      2580
     cgtatcaaca tggacggcaa ctccatcacg aacttcagtg tgattggatc ctccgctcca      2640
     gaccaccgct tcctaaaccc gtccccagat ggtctgaacc ggatccaact gtggagtcgt      2700
     acatgggaca acaagtggac tgtcgatgtc gacttttcca agcatgactc gtctgagacc      2760
     gatgaggtcg acgagtcctc catcacgggc cgcatcacct gcctatggag cgacaataac      2820
     cgagttggcc tcatccccgc tctcgacgag gtgaggcagt tcagtccggc gtgggtggct      2880
     gtgaccaagt tttctgatgg gttgattgag ggatctcgag cattcgagat caagcgttcg      2940
     agcctcgggg ctttggggtc ttga                                             2964
//

If you have problems or comments...

PBIL Back to PBIL home page